Detailed information on CNT30100513


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690874Oryza rufipogonOryza sativa27.3750.16100153forward
CNT30676253Oryza rufipogonSetaria viridis21.1148.7684.75118forward
CNT30595486Oryza rufipogonOryza meridionalis46.5146.6893.46260forward
CNT30575151Oryza rufipogonOryza barthii101.6180.4591.55568forward

Expression of CNT30100513

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MHTCNYGEKVIKHINRSFLRSFDRDRSSIGRRRASWRPSSRGARGRRTPRRPARPPPPSCSRCLWCFFSLS*

>peptide 2 (51 aa)
VRYCTFHKLSRVLRPSFQRRKIKRNQNFCVQHKRTYLILSADTELMYMNTK*

Sequence

>CNT30100513
GTGAGATATTGCACATTTCACAAGCTTAGCCGTGTCTTACGCCCTTCATTTCAAAGAAGAAAAATAAAACGAAACCAAAATTTCTGTGTGCAGCACAAAC
GCACTTATTTAATACTCAGTGCGGATACAGAATTAATGTACATGAACACGAAGTAAAAGCGACGACGTATGACGACGAACAAGAAGAAGCAAATTAAGCC
ATCAACCACATGCATACATGTAATTATGGGGAGAAAGTAATTAAGCATATAAACCGTTCGTTCTTGCGTTCATTCGATCGGGATCGATCTAGTATTGGTC
GGCGGCGTGCTTCTTGGCGTCCTTCTTCTCGTGGTGCTCGTGGAAGGCGAACCCCGCGGCGCCCAGCGCGGCCACCGCCGCCGAGCTGCTCGAGGTGCTT
GTGGTGCTTCTTCTCCTTGTCGTAGTCCACCACGCCGGAGCTCTCCTCCTCCCCGTCCTTCTTGTGGTGGAACAGGTGGTGGTGCTTCTTCTCCTCAGCC
ATGGCTAGCTACTCACTGATTAATAATCTTAGCTTCCTTCAGACAGAGTTAGTCGGTTG