Detailed information on CNT30100462


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001859, E-value = 6e-80

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695692Oryza rufipogonOryza sativa73.5870.7895.64390forward
CNT30555344Oryza rufipogonOryza glaberrima68.6873.6893.41364forward
CNT30110042Oryza rufipogonOryza longistaminata95.8597.8897.83508forward
CNT30577644Oryza rufipogonOryza barthii68.1173.2395.57361forward

Expression of CNT30100462

Peptides detected in this lncRNA

>peptide 1 (70 aa)
RPSRAKEREEEEAGLLKPLPSRPHLPLLLPATDEQGPCAFSSLATTDRARVRGSSGRRFRRRRPQRCARV*

>peptide 2 (42 aa)
DRAEQKSERRKKQASSSLCQAGPTFLYSFLPLTSRARAPFPL*

>peptide 3 (40 aa)
MKMKTSTRPPRSISRSKLSMKTSRCFVPSPKPRLWNKIDA*

>peptide 4 (31 aa)
TEPSKRARGGRSRPPQASAKPAPPSFTPSCH*

Sequence

>CNT30100462
AGACCGAGCCGAGCAAAAGAGCGAGAGGAGGAAGAAGCAGGCCTCCTCAAGCCTCTGCCAAGCCGGCCCCACCTTCCTTTACTCCTTCCTGCCACTGACG
AGCAGGGCCCGTGCGCCTTTTCCTCTCTAGCAACCACCGACAGAGCCCGAGTTCGAGGAAGCTCCGGACGCCGCTTTCGAAGGAGAAGACCCCAACGCTG
TGCAAGAGTATGAAGATGAAGACATCGACCCGACCGCCGAGGAGCATCTCCAGGAGCAAGCTGAGTATGAAGACTTCTAGATGTTTCGTGCCTAGCCCCA
AGCCTCGCCTGTGGAATAAGATAGATGCCTAGGTTCTTCGCCTAGTGCATAGTTGCTTAGTCGCTTAGTGCTCCGCGCTGTTCGCTTCTGCACCGTCGCT
TTTATGGTTTTCTGTAATGTTGTGTTGCTCATCTATGGGTCTGTCCATGATAGCAACTTATGTAAGGACTACTACCCAGTGATGTAATAAAGCAGTTTAT
TTGATTCCACATTTAATCTGTGTGTACCAG