Detailed information on CNT30100439


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9FN42|CLPP2_ARATH, E-value = 3e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671320Oryza rufipogonSetaria viridis15.9429.6689.39132forward
CNT30520174Oryza rufipogonSetaria italica44.6934.5889.73370forward
CNT30190828Oryza rufipogonSecale cereale25.7217.5390.14213forward
CNT30301287Oryza rufipogonTriticum aestivum24.1521.0591200forward
CNT30666936Oryza rufipogonTriticum dicoccoides47.2231.8489.77391forward
CNT30139438Oryza rufipogonLolium perenne46.9831.9190.49389forward
CNT309286Oryza rufipogonZea mays30.1945.2186.8250forward
CNT30686790Oryza rufipogonTriticum urartu34.352.0188.38284forward
CNT30720370Oryza rufipogonTriticum spelta44.3231.2386.1367forward
CNT30150243Oryza rufipogonBrachypodium distachyon14.7337.8992.62122forward

Expression of CNT30100439

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MSPQSRASSGSMKRSRSMHCSILSISWPVCFW*

>peptide 2 (43 aa)
MTRALGSARRSPRAPAASRREPMDAAWPMQSVVTGQRMYCMVS*

>peptide 3 (58 aa)
MAMGHEKVSPLRPQLTPRRAPRHLCPFRRRQRRCGAAGQRQWRPRVSGTRGGSQLPRR*

Sequence

>CNT30100439
TGGAAGGAATAAAATTTCCTTAGATTTGCAATAAATATCAGCAGTAGCTCAATTCAGGCAATCAAGACAACATGTAAGGAGCCGAACACATCGGCAACCT
GAATAACAAGTGGCAACCTGAATAATAACAAGTTAAGTTTATGTAGTATAAGAACTGAACCTTGGATCTAATAACAACAACAACATGGCCATGGGACACG
AAAAGGTTTCACCTTTGCGGCCACAGCTCACACCGCGGAGGGCTCCTCGACATCTCTGCCCCTTCCGCCGACGCCAGCGGCGCTGTGGTGCGGCAGGTCA
ACGCCAGTGGCGCCCTCGGGTATCAGGGACGCGGGGCGGTTCTCAATTACCTCGTCGATGAGCCCCCAATCGCGCGCCTCCTCGGGGTCCATGAAGAGGT
CGCGCTCCATGCACTGCTCGATCTTGTCGATCTCCTGGCCGGTGTGCTTCTGGTAGATCTTGTTGAGGCGGTCGCGCAGCTTGAGAATCTCCTTGGCCTG
GATGGCGATGTCGGTGGCCTGGCCCTGCGCGCCCCCGGATGGCTGGTGAATCATGACCCGCGCGTTGGGCAGCGCCCGGCGCTCCCCGCGCGCGCCGGCG
GCGAGCAGGAGGGAGCCCATGGACGCGGCCTGGCCGATGCAGAGCGTGGTGACGGGGCAGCGGATGTACTGCATGGTGTCGTAGATCGCGAGCCCCGCGG
GGAGCGGCGAGGCGGAGGCTAGGTGGGCGAGGGCGGAGGGCGTCATGGCTGCCGCTGCCGGTTCGGATTGGATTCGGGGATTTCGAGCGAAGTGAAATTT
GGGGATATGAGATGGGGAGGAAGGTGAG