Detailed information on CNT30100427


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30106204Oryza rufipogonOryza longistaminata32.1116.7497.92192forward
CNT30575152Oryza rufipogonOryza barthii66.7210099.5399forward

Expression of CNT30100427

Peptides detected in this lncRNA

>peptide 1 (54 aa)
TPAAAADTRTRRRLRRRRRPPARPADGEQLARTCARTHLPFDKMVQTCATAYSW*

>peptide 2 (37 aa)
MHMHACVMCRTSSSLALACTYFQYICILYFLYIVIIL*

>peptide 3 (29 aa)
HQRRRRTPAPAAASAAAAVRRRGLLMASN*

Sequence

>CNT30100427
GACACCAGCGGCGGCGGCGGACACCCGCACCCGCCGCCGCCTCCGCCGCCGCCGCCGTCCGCCGGCGCGGCCTGCTGATGGCGAGCAACTAGCACGTACG
TGCGCACGCACCCATTTGCCATTTGATAAAATGGTTCAGACCTGCGCTACAGCCTACAGCTGGTGAACTGCAGAAGGGGAAGCAGTACTAGTCGTGGTGC
TTCATATATCGCACCTACTTGTTGTTCTGTCATCCTTCAAAGACATCGTCAGTCCCAGTGTGCAGCTGATCGACAACGACCGCACTGAGACGGACCACCG
CCGCCGTCGATCGAGCATGCAGAGATCGACCAGAATCGATCACAGCATCTCGACGGCCTTGTCAGCATTGGATCCAGTCCATCGATCGGTAGCCCGGCCC
TAACGTACGCCAGAACTAGCTAGTTCAGCTAGACCAATCCCAGCATTATGCATATGCATGCCTGCGTGATGTGTCGTACGTCTTCTTCATTAGCATTAGC
GTGTACGTACTTTCAGTATATTTGTATTTTATATTTCCTATATATTGTTATTATTCTGTGACTATAGTTTGTGCGCGTGTGAGATACTGAAACTTCCC