Detailed information on CNT30100371


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30108176Oryza rufipogonOryza longistaminata60.66101.4688.9694forward
CNT30575438Oryza rufipogonOryza barthii56.9910099.54652forward

Expression of CNT30100371

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MHLLSRLWFRENSWVFLFASLLCTVYAVYFYYLICRHFSFGFINSGNNFNLYAH*

>peptide 2 (66 aa)
MRAPLGGQHMGVRAPQSVEAREGCDWVSQARGAVEASGGRWGRRLRALGVCVASSIRAGGRSLSRS*

Sequence

>CNT30100371
AAAAGTTACAGTGTAAGTTTCATAAATTACACTGTAACTTACAAGAAAATGCACTGTAAATTTGAGTGAGAAAATCGAGTGAGAGATAAGAAAAAATCTT
TCGAGTGAGATGTAGCAAAATCGTTCTCAAAAATCTTAATAAATAGGCCCATCGACTGGGAGAGAAGGAGCGATGGCCTACAGCTTTGCTTAGGTTGGTT
GCACTGGGGCGTGTCCTGTGGCCTTTCAGTAGAAAAAATGGTGGCCCGGATGTATCAGAACTAGGCTAGGGCCCAGCCCAGAGGGCAGTGTTGACCAGCT
TTGACCACCTTACCCAACTCCTTGTGCGATTGAGCCAAACCCCAGCAGCGAGCGCAACGGCAACGGCCTTGTTGGCGACTGGCCGCCGCCGCCCGCCGGC
GGCCGGGCGGCCAGCGGGGGGTGGCTGATGAGGGCTCCGCTGGGCGGCCAGCATATGGGGGTGCGGGCGCCACAGTCCGTAGAAGCGCGGGAAGGCTGCG
ACTGGGTAAGCCAGGCGCGTGGAGCGGTGGAGGCAAGCGGCGGCCGGTGGGGGAGGCGGCTGCGTGCGCTCGGTGTCTGCGTCGCATCGAGCATTCGAGC
TGGTGGAAGGAGCCTATCGAGGAGCTGAGCAAGCGAGCTGTGGTTCCCGATTACTGATTTCCTGGTGGCTGAAAATCAGCGACGGAAGGTATCTCAAAGA
GATTTGAATAGCTATTTTAACCGTGGGTGATGTGCCACCAACCCCAACTACTTGTGGCAATGGAATTGTTGCGGTGGAAGAGGCTGCGCTGAACAGGTAG
AAGGGGTCGTGGAAGTACAATTGGGTTCATTTCATATTGCTGGACGAGCGGAAGAGAGAACTCAACGTCCAGTGGCTAGTGAATCCAAGTGAAGATGCAC
CTGTTATCCAGGCTCTGGTTCAGGGAGAATAGTTGGGTGTTCTTGTTTGCAAGTTTGTTGTGTACCGTCTATGCAGTATACTTTTATTATTTGATTTGCA
GACATTTTAGCTTCGGTTTCATTAACTCAGGCAACAATTTCAACTTATATGCCCATTAATTATCTATTTGTAGTGCGTGTTATATGGCATTAATCTTTTT
ATAGGTAAATAATATCATGCATAAGTGTGCCTATTGACTTCTCC