Detailed information on CNT30100370


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691491Oryza rufipogonOryza sativa101.0462.6698.971069forward
CNT30184327Oryza rufipogonSecale cereale4.9124.4194.2352forward
CNT30587177Oryza rufipogonMusa acuminata6.5221.0485.5169forward
CNT30552575Oryza rufipogonOryza glaberrima92.3499.998.57977forward
CNT30369514Oryza rufipogonOryza glumipatula100.4790.0898.491063forward
CNT30107388Oryza rufipogonOryza longistaminata96.0399.998.621016forward
CNT30575322Oryza rufipogonOryza barthii89.5110099.58947forward

Expression of CNT30100370

Peptides detected in this lncRNA

>peptide 1 (46 aa)
RARAPSSRRVRRPDPAHAPPPFEPPSPAPPRATARRSRTDLVNSPP*

>peptide 2 (45 aa)
MPFSASSRRPLPSTVPVRRARGFSDSCKGMVTSLWQQLHILQENL*

>peptide 3 (54 aa)
MNSSTYEHLARLRRLYIVYWLPLLNVSLITHDMLAWKGNFELIMRPVTILSSEL*

>peptide 4 (41 aa)
APARRPHAASAAQIRRTLLPLLSRHRRHRRARRRGAAAPIS*

>peptide 5 (29 aa)
MRLNNICLLLEGKRCMTVLKQMKNSSFYEV

Sequence

>CNT30100370
CGCGCCCGCGCGCCGTCCTCACGCCGCGTCCGCCGCCCAGATCCGGCGCACGCTCCTCCCCCTTTTGAGCCGCCATCGCCGGCACCGCCGCGCGCGACGG
CGCGGCGCAGCCGCACCGATCTCGTGAATTCCCCTCCCTGACCACTCTCCCGGCCCCGGCCCCAGCCACCACCTAAATCGCAATGCCTTTCTCCGCTAGC
TCCCGCCGTCCCCTCCCCTCGACGGTGCCGGTGCGGCGCGCGCGTGGTTTCTCAGATTCATGCAAGGGGATGGTGACAAGCTTGTGGCAGCAACTGCACA
TCTTGCAAGAAAATCTTTAGGGTTTTTCAGACCATACCGATGATTTTCTTGCAAGTTGTGCAGTTGTTGTCTCAAGCTTGCTGCCTCCCTTTGCCAAAAC
TATCAAGTGAGAAAGCAGGGTAGAGTTATTCAATTACAGGCACACAAGACAAAATTAAAGTAATAAACATGTCTGACCAACAAACACAATGATTAATAAC
AAAACTCTTGTGGCATGAGATAATATTGAAGCATGATGCTTACAACAGTTATAATATGAAAACTAGATGGAGGCAGGCAATTGCAAATGAACTCATCAAC
ATATGAACATCTAGCAAGATTACGTCGTCTCTACATTGTGTATTGGCTTCCACTGCTGAATGTTTCTCTTATTACCCATGACATGCTTGCTTGGAAGGGC
AATTTTGAGTTGATCATGAGGCCAGTCACAATTCTTAGTAGTGAATTATGAATTTCTAAATGCATTATGTTAGTTTCATGGCTTGATCCTTGGTTTCTTT
GTTTTGTAGGTTTGCATGAATTTCTCTAGGAATGCCCAGTGAGTGATCCTGTAAATTTTGGAGTTGATTGTTCATCAGAATAGCACTATAATTTTCCTGT
CACCTGTGCTTTGGTAGCGGAACGTTCATTGTCCCATGCTACTCAGCTTTGTACTTTTGTAAATCAAATGAGACTGAATAATATATGTTTACTTTTGGAA
GGAAAAAGATGTATGACTGTTCTCAAGCAAATGAAAAATTCCAGCTTTTATGAAGTTA