Detailed information on CNT30100358


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003145, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691349Oryza rufipogonOryza sativa40.5101.4797.73484forward
CNT30552667Oryza rufipogonOryza glaberrima55.7383.9898.2666forward
CNT30575146Oryza rufipogonOryza barthii70.79101.298.58846forward
CNT30116022Oryza rufipogonOryza nivara53.8183.497.82643forward

Expression of CNT30100358

Peptides detected in this lncRNA

>peptide 1 (85 aa)
VRIPSPRGLVHDTLGRVFGWHVLKPALLLERKRQSVHACSVRVRCNIRLSERRPRYCLLSHFSITRPIQRWMAQENITPCQLKSP*

>peptide 2 (31 aa)
MRTRSASQSTYQLARGVCYSRFTLARNAHYQ*

>peptide 3 (61 aa)
MDGSRKYYALPTEKPIRVSKEAHENKVRQSIHVPVGSRCLLLSFHTGPQCTLPMNQERTNT*

>peptide 4 (74 aa)
MWQGRLRLGVITLDLLHGDGGVVVVIAVSHHGSRSWRGRGRHHGCSLATLVALRVPLILHDRSMDSAKASRELK*

>peptide 5 (81 aa)
CGFRRQEVWYMTRWGVCLVGMFSNPHCCLSASAKVYTLVLFAYAAISVSRRGGPDIVFSLTSRLQGPSKDGWLKKILRLAN*

Sequence

>CNT30100358
GTGCGGATTCCGTCGCCAAGAGGTTTGGTACATGACACGCTGGGGCGTGTGTTTGGTTGGCATGTTCTCAAACCCGCATTGCTGCTTGAGCGCAAGCGCC
AAAGTGTACACGCTTGTTCTGTTCGCGTACGCTGCAATATCCGTCTCTCGGAGAGGAGGCCCAGATATTGTCTTCTCTCTCACTTCTCGATTACAAGGCC
CATCCAAAGATGGATGGCTCAAGAAAATATTACGCCTTGCCAACTGAAAAGCCCATAAGAGTTTCAAAAGAAGCCCATGAGAACAAGGTCCGCCAGTCAA
TCCACGTACCAGTTGGCTCGCGGTGTCTGTTACTCTCGTTTCACACTGGCCCGCAATGCACACTACCAATGAACCAAGAGCGGACCAATACATGAGGCAC
ATGATTGAGAAGATCTAGTAGAAAATGTGATCACAATGCAGTGTACCCCAGTAGAGTAGTACAGTACAACTGTACAAGGCAACAATATATTCTGGGCAGA
AATCATTAATACCAAGGCAGAATGCCCAGCCCAAAACCAATACAAGAGTGCCAATAATAATTAAACAAACTCAACATCTAGTACTTGACTATAGCAAACT
GAAGCCCGTACCCCACACGAAACACAAACTTCGATCACTGATCGGGCTTCGCTGACCAGGCCTTGACCAATCTTGACACGAACTTAACAAAGCTGCAGTG
CAGAAAAAGCACCAAACTAACACACGCCAAACACTTCCAAATTCCAACCATGGCCTGGTCTCACACACGCCCCAATTAAGCGCTGCTCTTGTGCTCGCCG
GTGGCGGCGGCCGGCGGCGGCACAGCAGTTGCGTCTTCCGGCTTCTTGTGGCCGCCGGGCAGCTTCTCCTTGATCTTGTCGAGGAAGCCCTTCTTCTCCT
CCTCGGGTGCATGTGGCAGGGTCGCCTCCGTCTTGGCGTGATCACCCTCGATCTTCTCCACGGGGACGGCGGTGTCGTGGTGGTGATCGCCGTGAGTCAC
CACGGGAGCAGGAGCTGGCGTGGGCGCGGCCGTCACCACGGATGCAGCCTCGCCACCCTGGTGGCTCTCCGTGTTCCTCTCATCCTCCATGATCGATCGA
TGGATTCAGCTAAAGCCTCTCGAGAACTAAAGTAATCAAACAACAGATCAGCAAGAACTATTCGCTCTTGACTTGTTTGAGCTGTGACGAGTCGC