Detailed information on CNT30100324


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000028, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695999Oryza rufipogonOryza sativa14.4921.0787.66154forward
CNT30554901Oryza rufipogonOryza glaberrima14.8630.594.94158reverse complement
CNT30577852Oryza rufipogonOryza barthii40.2697.0589.72428forward

Expression of CNT30100324

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MFLRFLNFFIPVKNIAPVWANIGINGQNFAARIMK*

>peptide 2 (35 aa)
MSKNHFWCFLNFFIPVKNIAPVWANIGINGQKFAA*

>peptide 3 (35 aa)
MFWCFLNFFIPVKNIAPVWANIGINGQKFAARITK*

>peptide 4 (33 aa)
MDKSSPRESRSEFLPRTHPIYSNMSKNHVLAFF*

>peptide 5 (49 aa)
MATTDTSVAHIMDEQQDIKFESSKCQNPIRPPATLLTSNGRRSSIRPLFL

>peptide 6 (51 aa)
MDKNSPRESRSEFLPRMHPIHSNMSKNHVLVLFEFFHSGKKHRAGVGQYWH*

>peptide 7 (57 aa)
MAILALVEKSSPRESQSEFLPRMHPIHSNMSKNHVFAFFELFHSGQKHRTRVGQYWH*

Sequence

>CNT30100324
TTTTCATTCCGGTCAAAAACATCGCACCCGTGCGGGCCAATATTGGCATTAATGGACAAAAGTTCGCCGCGCGAATCATGAAGTGAGTTTTTGCCACGAA
TTCACCCAATACACTCCAATATGTCCAAAAATCATGTTTTGGTGCTTTTTGAACTTTTTCATTCCGGTTAAGAACATCGCACACGTGTGGGCCAATCTAT
GGCAATATTGGCATTAGTTGAGAAAAGTTCGCCGCGCGAATCACAAAGTGAGTTTTTGCCACGAATGCACCCAATACACTCCAATATGTCCAAAAATCAT
GTTTTTGCGTTTTTTGAACTTTTTCATTCCGGTCAAAAACATCGCACCCGTGTGGGCCAATATTGGCATTAATGGACAAAACTTCGCCGCGCGAATCATG
AAGTGAGTTTTTGCCACGAACGCACCCAATACACTCCAATATGTCCAAAAATCATTTTTGGTGCTTTTTGAACTTTTTCATTCCGGTCAAAAACATCGCA
CCCGTGTGGGCCAATATTGGCATTAATGGACAAAAATTCGCCGCGTGAATCACGAAGTGAGTTTTTGCCACGAATGCACCCAATACACTCCAATATGTCC
AAAAATCATGTTTTGGTGCTTTTTGAATTTTTTCATTCCGGTAAAAAACATCGCGCCGGTGTGGGCCAATATTGGCATTAATGGACAAAAGTTCGCCGCG
CGAATCACGAAGTGAGTTTTTGCCACGAACGCACCCAATATACTCCAATATGTCCAAAAATCATGTTTTGGCGTTTTTTTAACTTTTTCATTCCGGTCAA
AAACATCGCACCCGTGTGTGCCAATATATGCCAATACTGGCATTGATTGACAAATGTTCGCCACGCGAATCACGGAGTTTTTGCCACGAACGCGCCCAAT
ACTGATGTGACCATGGCTACTACGGATACATCCGTTGCTCACATCATGGATGAACAACAAGATATCAAGTTCGAGTCCTCCAAGTGCCAAAATCCAATTC
GGCCACCTGCTACACTGCTGACTTCGAACGGCCGCCGAAGCTCCATACGACCTCTGTTTTTGG