Detailed information on CNT30100316


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552499Oryza rufipogonOryza glaberrima10093.9999.19986forward
CNT30595723Oryza rufipogonOryza meridionalis57.6185.1697.71568forward
CNT30575214Oryza rufipogonOryza barthii10088.0498.88986forward
CNT30116540Oryza rufipogonOryza nivara95.0310099.79937forward

Expression of CNT30100316

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MFHATFIGENTINYQGIHMFLAIYHIWKTCKVH

>peptide 2 (46 aa)
SRRRFLTPVAESKLIRLVPPSRSPLPERPSRSSICSTYWPLPVLCS*

>peptide 3 (72 aa)
IASPVSHACCRVQVDPIGSSVEVAPAREAKPIQHLLHLLAPPRSLLLTPSDINHRPPATAPAPCCSHDCDDT*

>peptide 4 (37 aa)
MIVMTHNLDLQLTVSIFSSRNIGDIMAGAAWSQSPTP*

>peptide 5 (44 aa)
MLEHIVLKLVYLYVSCDIYWGKHNKLSGYSHVSCYLPYMENVQSA

Sequence

>CNT30100316
ATCGCGTCGCCGGTTTCTCACGCCTGTTGCCGAGTCCAAGTTGATCCGATTGGTTCCTCCGTCGAGGTCGCCCCTGCCAGAGAGGCCAAGCCGATCCAGC
ATCTGCTCCACCTACTGGCCCCTCCCCGTTCTCTGCTCCTGACACCGTCTGACATCAACCACAGGCCACCAGCAACTGCACCTGCACCCTGTTGCTCGCA
TGATTGTGATGACACATAATCTCGATCTGCAACTCACTGTCTCCATTTTCTCAAGCCGGAACATTGGGGATATTATGGCAGGAGCAGCGTGGAGTCAAAG
CCCTACTCCGTAGAGGGCTCGAGGCTGCGCGGATCGCTTCCTCTCTTTGAACACAGCTGGGGTGTGCGACATGGCTGTGGTGGAGGATCTGCCCCCACCC
AGGTTGAACATGGTGATTTCAGACATTTATCAATGATGGATTATCTGCTTGCCTATTCTTTCTGTTACATCAGTTGTGGGATGTTTTTCTGTTAAATTAA
TCTAGGTTGCTCTCTTGATCTGGTCTAGACAGATCCTAAGCAAAGGTTGCAATAAGGAAAACAAAAGGAAAAGCTCAAAATATCCATGTCAACTTGAAGA
TATTGTGGATTGCAGATTGTGAGGGTTACATTTGAAGTTATTGTGGATGACACGAATCAATTGTGTAGATACTTGTGTTATTTTCTCTTACTTAGTGGAG
TTCTCTTGAATGCATCTGAAGACAACTCTTTTGCTTTGAGCCTTTCAAGTGTTTGTTAAGTTGTGGAAAATTGTATCCATTTTGTAATGTTGGCTACTTT
GCACCTCCACAACAAGTGTCCAAGAGGGGGTAACCAAAATAGGCTAGATCATGTTAGAACATATTGTTCTTAAACTTGTGTATTTGTATGTTTCATGCGA
CATTTATTGGGGAAAACACAATAAACTATCAGGGTATTCACATGTTTCTTGCTATTTACCATATATGGAAAACGTGCAAAGTGCAC