Detailed information on CNT30100307


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552705Oryza rufipogonOryza glaberrima49.652.7190.27185forward
CNT30575149Oryza rufipogonOryza barthii54.9643.6297.07205forward

Expression of CNT30100307

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MRRREGRKMGGCRRGGRRRRRLGRWGRKGGRRRRGSGRGGGCPPWLMAVWTVNEEE

>peptide 2 (68 aa)
LAAWGGELKRGDAVGEGVVEKEGIAEGGAGGGYRWGRGWEEEVKVEVEVEMVVEGGVEVVGGGETEWA*

>peptide 3 (59 aa)
LLRGAASSSAETRWAREWWRRKGSRRAGQEVVTGGVGVGRKRSRSRSRSRWWWKAASRS*

>peptide 4 (62 aa)
CCVGRRAQARRRGGRGSGGEGRDRGGRGRRWLQVGSGLGGRGQGRGRGRDGGGRRRRGRRRR*

Sequence

>CNT30100307
CTTGCTGCGTGGGGCGGCGAGCTCAAGCGCGGAGACGCGGTGGGCGAGGGAGTGGTGGAGAAGGAAGGGATCGCGGAGGGCGGGGCAGGAGGTGGTTACA
GGTGGGGTCGGGGTTGGGAGGAAGAGGTCAAGGTCGAGGTCGAGGTCGAGATGGTGGTGGAAGGCGGCGTCGAGGTCGTAGGAGGAGGTGAAACCGAGTG
GGCATGAGGAGGAGGGAGGGAAGAAAAATGGGTGGGTGTCGTCGAGGAGGAAGGAGGAGGAGGAGGTTGGGAAGGTGGGGAAGAAAGGGTGGTCGTCGGC
GGCGAGGAAGCGGAAGAGGTGGTGGCTGCCCCCCATGGCTGATGGCAGTGTGGACTGTGAATGAGGAGGAGCG