Detailed information on CNT30100211


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003266, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691303Oryza rufipogonOryza sativa80.2412.99100406forward
CNT30108168Oryza rufipogonOryza longistaminata99.4121.6199.6503forward
CNT30575176Oryza rufipogonOryza barthii99.4176.33100503forward
CNT30115971Oryza rufipogonOryza nivara100.223.2799.8507forward
CNT30550641Oryza rufipogonOryza brachyantha75.123.381.58380forward

Expression of CNT30100211

Peptides detected in this lncRNA

>peptide 1 (44 aa)
RCPKWVHVNSDTSCPKWQGKVHMYKFRYILSKMAREVHKLRTRW*

Sequence

>CNT30100211
ACGTTGTCCAAAATGGGTTCATGTAAATTCAGATACATCTTGTCCAAAATGGCAAGGAAAAGTACATATGTATAAGTTCAGATACATCTTATCCAAAATG
GCAAGAGAAGTACACAAATTAAGAACAAGATGGTAACACCGACATAGGTTCCTACAGCAGCAAAATACAATACAGGTAGCAGGCACCATGGTTAAATAGG
TTACATACAATGCTTGGATATAACTCAGACAACTAAAACCTATCGAGTGAATATCTCAGGCAGCCTGTCCGCCCAAGAGACAAGCCCACGGACTAATGGT
TGGCCTACAAGGGCAGATCGATCTGGCGATTCTGAACTAACCTACTACTATACTCACTTTGAAAGGACTGTGTTCTAGTTACAGGTAACCAGGTCTTCAG
CTTCACCATCCTACAACTACTATGATCACTGCTCACATTGAAAGGACTGTGTTCTAGTTACAGGTAACTAGGCCTTTAGCTTCGATCACCATGGACCCGT
CAGAGT