Detailed information on CNT30100206


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8GU88|AB39G_ORYSJ, E-value = 1e-133

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552520Oryza rufipogonOryza glaberrima88.9492.7298.861311forward
CNT30345961Oryza rufipogonEragrostis tef3.4621.1690.251forward
CNT30571661Oryza rufipogonVitis vinifera6.3835.2187.2394forward
CNT30706482Oryza rufipogonPrunus avium7.651.6182.14112forward
CNT30108659Oryza rufipogonOryza longistaminata37.9981.7599.46560forward
CNT3021870Oryza rufipogonPopulus trichocarpa10.8562.0280.62160forward
CNT30150571Oryza rufipogonBrachypodium distachyon16.2829.8185240forward
CNT30575121Oryza rufipogonOryza barthii40.9182.0499.83603forward
CNT30603608Oryza rufipogonOryza punctata15.0665.4995.05222forward

Expression of CNT30100206

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MRWCSYLLWKLKTLMEKAKTNAKRAANPTTAVAT*

>peptide 2 (35 aa)
MHMVERSTFQRPFLGRTLFAQRLQLVGQSGRFEFQ*

>peptide 3 (40 aa)
MRAITVVKKILVAVYDGFLQYDLCCFHRQAMHCVKKGCEN*

>peptide 4 (44 aa)
MPIRRPAHGRIVAAAARVTPALGRRGSGAVCQYSTANLSKLESR*

>peptide 5 (33 aa)
MPLGMPRNTTSTILVSSANQPCIFQHQQYRKKT*

>peptide 6 (98 aa)
EPNPGAKSEVPRDRADRRRCRSGGRPTGGSWPPPPALLRRLVGVALVLCASTQQQTYPNLNQDEMVLLSSLEIEDFDGEGKDEREESSKPNNGSCYIT*

>peptide 7 (60 aa)
LNPTQARNPRCPATALTGGDADPAAGPRADRGRRRPRYSGAWSAWLWCCVPVLNSKLIQT*

Sequence

>CNT30100206
CTGAACCCAACCCAGGCGCGAAATCCGAGGTGCCCCGCGACCGCGCTGACCGGCGGCGATGCCGATCCGGCGGCCGGCCCACGGGCGGATCGTGGCCGCC
GCCGCCCGCGTTACTCCGGCGCTTGGTCGGCGTGGCTCTGGTGCTGTGTGCCAGTACTCAACAGCAAACTTATCCAAACTTGAATCAAGATGAGATGGTG
CTCTTATCTTCTTTGGAAATTGAAGACTTTGATGGAGAAGGCAAAGACGAACGCGAAGAGAGCAGCAAACCCAACAACGGCAGTTGCTACATAACCTAAG
TAGTCATGCCTAAACCCAAAGTATCGTCTGATGTAATCTTGCACCACTTCCCCGTCCTCCAGTGTAGAGTTTGTGATATCACCATATTGTGAGGCAACAA
GTCCGTACAGTGTCCATGCCACTGGGCATGCCCAGGAATACCACCTCCACCATATTGGTATCCTCTGCAAACCAGCCATGTATATTTCAGCATCAACAGT
ATAGAAAAAAGACTTAAAGGTTGGTATGGACAATGAATGAATATCAGATACTTACTGGTCGGGGGATTAGGAAGCCGGCAAAGATATTCCATATGCAATA
GAATGCAGTAGAGACTATGGCAGCAATGTCGCTGTTTGGTGTCATGGCGACTGCCATCATCCCATAGAATGTGAAGTACATGAAGGTGAAGAACATGAAG
AACATGTACCAGAAGAATTTTTCAACTGTCCAGTCAAAGCCAATCAGGCTGTAGACGATCAGACCATACACGACAGTCTGGAGGAAGATGTGTGCTATGA
CCATTTACCTGCGCAAATGCATATGGTAGAGCGGAGTACATTCCAGCGGCCTTTTCTCGGTAGAACACTGTTCGCTCAACGTCTACAATTGGTTGGACAG
TCTGGCCGTTTTGAATTCCAATGAAAAGGACTGCTGCATACATGGATCCCAAAGAGTTGAACAGATCCAATCTCTTGTTTCTGTAGGCAAGATAAGCACA
GGTTCAAGAATATAGTGCCGAAAATGAGGGCTATAACTGTTGTGAAGAAGATTCTAGTTGCTGTATACGACGGATTTCTCCAGTATGATTTGTGCTGCTT
CCACAGGCAAGCCATGCATTGTGTGAAGAAGGGCTGTGAAAATTGAGTTGGGAAGTGTAGGTCCGTTGATCCAGGTGGAGGTGTGCTTAATTCACTTATC
AATGTTTTATTCCTCCTGCAATGGTGCAATTGAATCAGTGATATAACACAGAAAAAGCAGAAAAAGAACATTTTGGGGGGCTTTTGTCATGAAACATACT
GGATTGTAACCATCCTTGATTTTCCTCACTCCTTGTATACCCTAAATTTGGAGCAGCGAGCAAGGTTACCATGCATGTCTTAAGTTGGAAATTTGGTGTT
CACTTCAGTATTTAAGTATCGAGGCTCACCTCAAAGTAATTGATGAGATGGCATGAGTTGTGTCCCAGGGGGCC