Detailed information on CNT30100170


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SK39|SBP3_ARATH, E-value = 4e-33

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30519964Oryza rufipogonSetaria italica33.729.4994.34212forward
CNT30667282Oryza rufipogonTriticum dicoccoides33.747.6490.09212forward

Expression of CNT30100170

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MGRSRRTPAAAPPSAPPPSLSPLSFSLLAAVCGSVEGCWVVGLVASGEVKRWRKR

>peptide 2 (51 aa)
KKSSGNHKKERPDNPILKLLPRFLIVQIIGQLIKQPESKAASTDTLTHREK*

>peptide 3 (32 aa)
TRNQAAITKKKDQTIQYLNYSPDFLLFRLLGS*

Sequence

>CNT30100170
ACAAGAAATCAAGCGGCAATCACAAAAAAGAAAGACCAGACAATCCAATACTTAAATTACTCCCCAGATTTCTTATTGTTCAGATTATTGGGCAGCTAAT
CAAGCAACCAGAGAGCAAAGCTGCAAGCACAGACACACTGACACACAGGGAGAAGTAATAATAAGTTACACATGGAATTACGGATGGAATTAAGCTGTAG
AGCACAAGAGGATACAATAATCTAAGGGTTGATTTGGGGGGATTTTTTTTTTTCATTCGGTGAGGCGGGCGACGACGGGGTACTTGGCCTGGAACTTGGT
CTCCCAGTCGCCGGAGACGTCGGCGTCGTCCTTGGACATCTTGCCGAGCGCGCGGCTGGCCTCGCGGCCGGCGAAGACGGCGTAGGCGCCGCCGGGGCCG
TAGAAGCCGCGGCCGGAGGTGACGTCGTAGACCTTGCCGCGGACGGAGACGTAGATCGGCTTCGATGGGTCGCTCCCGTCGTACGCCCGCAGCTGCGCCG
CCGTCAGCTCCGCCGCCATCTCTCTCTCCTCTCTCTTTCTCTCTCCTCGCGGCTGTGTGTGGATCAGTGGAAGGTTGTTGGGTTGTGGGCCTTGTGGCTA
GTGGGGAAGTGAAGCGGTGGAGAAAAAGG