Detailed information on CNT30100167


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001849, E-value = 1e-86

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693614Oryza rufipogonOryza sativa15.9537.2781.08259forward
CNT30552110Oryza rufipogonOryza glaberrima22.1131.8594.15359reverse complement
CNT30108479Oryza rufipogonOryza longistaminata3351.198.13536forward
CNT30575330Oryza rufipogonOryza barthii26.620.1297.69432forward

Expression of CNT30100167

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MIYQGGEETNTLARTNTGAQPWRNLSLRQREKARVRNWVI*

>peptide 2 (30 aa)
MAKPLMVWRDFWKVKINPNYNYVTRKFKLF*

>peptide 3 (60 aa)
MSNIQPQYNSDNWKYSTNKRHCKQSAYTYTYTNNTIHHIFEYTVAQDMHSLTLLCTKGNM*

>peptide 4 (43 aa)
MQDSAQSISRTNPSIPIVSSQISSQPNTHTISMSARKGRRKIG*

Sequence

>CNT30100167
AAAACACCAAATAGAATCCTAATGACGATTAAAAGGAGGGACATCAGGCATGCCGTGAAGTAAACAAGTAAAGCGGTTGCCGGGACTTCTAGAAAGTATA
AAGAAAAAAAACCACATTGATAATCATTTTCGATTTTTAAAATCTCAATGACAATAAAAAGGAGAAGCAACGAGCAGGGTGTATAAGAGTATAGTTGTAG
AGCCTCCGACGGTTGACAGGACTTCTAGAAAATAAAAAATAAAAAATGAATTGTAACGATAGTTATGTTCGATTTTTAGAATCACAATGACAATAAAGAG
TAGGCGGCGGACGGGCTGCAGAGGGGCATAGTGGCATCGTTTGATGAGACTTCTAAAAATTATAAAAAATAAAACTACAAGTCCAATTTTTAAAGATTTA
GAAATTCTAAAAAGTAAAAAAAACCAATGATAATCATGTTCTATTTTAAATCTCAATGACAATAAAGAAGGGAGGCAGCGAGTGAGCCGTAGAGGAGTAC
AATGGCAAAACCGCTGATGGTTTGGCGGGACTTTTGGAAAGTAAAAATAAACCCAAACTATAATTATGTTACCCGGAAATTTAAGCTATTTTAAAAATTA
AAAATTAAGTGGCATATATCACTAATTAATTAGTTAACTAGCAAAATTGTTGGAAATAAGAATAAGCCACTCAAAATTTATGAAATTCACATTCGTCGAA
GTTAAACAAACAAACAATGTCCAATATACAACCACAATATAATAGTGATAATTGGAAATATAGTACAAACAAACGCCACTGTAAACAGTCAGCATATACA
TACACTTACACTAATAATACAATACATCATATATTTGAATATACGGTTGCACAGGACATGCATAGCTTGACCCTTTTATGCACAAAAGGTAATATGTAAA
TAAATATTGCCGTCAGACCCATACACGAAGTGGTGTATATTCAACCATTCACCGAGATACCTAGATCGGCTAATACCGTCTGGCACCCCTCACTTAAGTT
GGGTTCGTCATCCGGCTAATTAACACTAAGAAGTCACACATCTCATATAAAGAAGTAACCTCACCAAAGGGACCTCAATTCACCAGCAGTACTAATTTTC
CACCAATCACATAGCTGCACATAGGAGGACTCACACAAGGCCACAAAGGTAGTAGCACAACCTCATCACCTCTCAGTCAAGCAGTCAAAGCATGGCTACA
GCCATGCCCATTTGCTCACTGATGCATGCATATGAGCCCCAAGCACTTGGTGAGGAGTGAGCAGATCAGGGGAGGAGGAGAGCAATAGGGAGCGAGGAGG
GAATAGCCAAAGTCCCAAAATCCACAAATCAGCGGAATGCAAGATTCTGCCCAATCCATTTCAAGAACCAATCCCTCAATCCCAATAGTTAGTAGCCAAA
TTAGTTCTCAGCCAAATACTCATACCATCTCTATGTCGGCTAGGAAGGGGAGAAGAAAAATTGGCTAGACAAGGAGATGATCTATCAAGGAGGAGAAGAG
ACCAACACATTGGCGAGGACGAACACGGGAGCACAACCATGGAGGAACTTGTCCCTTAGACAAAGGGAAAAGGCTAGAGTCAGAAATTGGGTCATTTGAT
AGTACCGGCTACAGAAACTCAGGC