Detailed information on CNT30100073


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30670550Oryza rufipogonSetaria viridis40.3526.6787.86140forward
CNT30519875Oryza rufipogonSetaria italica40.3521.1887.86140forward
CNT30139784Oryza rufipogonLolium perenne39.4825.3289.78137forward
CNT30369698Oryza rufipogonOryza glumipatula95.3962.9399.7331forward
CNT30575103Oryza rufipogonOryza barthii10095.3399.71347forward
CNT30584006Oryza rufipogonEchinochloa crusgalli39.4827.1386.13137forward

Expression of CNT30100073

Peptides detected in this lncRNA

>peptide 1 (57 aa)
QERVPFADATEIIDRLLQVVLVLPEYLLVQIDLPKTHFLKFLQQFLFCEIVNAMMIR*

>peptide 2 (54 aa)
ARRGSHSLTPQRSSTDCSRLYLFCLSISLFRSTCLKPISSSSFSSFSSVRLSMP*

Sequence

>CNT30100073
GCCAGGAGAGGGTCCCATTCGCTGACGCCACAGAGATCATCGACAGACTGCTCCAGGTTGTACTTGTTCTGCCTGAGTATCTCCTTGTTCAGATCGACCT
GCCTAAAACCCATTTCCTCAAGTTCCTTCAGCAGTTTCTCTTCTGTGAGATTGTCAATGCCATGATGATCAGATGATGATGCACCAACAGACGCAGGTGC
ATTACCAGCAGGCACATTAACAGTTGGAGGCACAGGAGTCACAGCAGTTGAACTGGAGGGAACATCAACATCAATGATGGGGTGAAGAGATGTTGTGGAA
GAAACAATGGGCACAGGTAATGGAGCAGGCTCAGGATTCTTGGGCTC