Detailed information on CNT30100063


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30552517Oryza rufipogonOryza glaberrima99.6180.2599.22256forward
CNT30575206Oryza rufipogonOryza barthii10096.9899.22257forward

Expression of CNT30100063

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MQAEQGDHMLLQIDSANKNRHHKGKNITEPGEPCGSFLLAFCYFNWTSN

Sequence

>CNT30100063
GGGCTAATTCATAGAGATTTGTGAGGCTGTGCAAGAGTCAGTAGTAATCAGGTAGGCACAAGGATCATCATCAAACACCATAAAAACTACTAGAAAGACA
TACTTGTACATGCAAGCAGAGCAAGGCGACCATATGCTCTTGCAGATCGACAGTGCAAACAAAAACAGGCACCACAAAGGCAAAAATATAACAGAACCGG
GTGAGCCCTGTGGCTCTTTCTTACTAGCCTTCTGCTATTTTAACTGGACAAGTAATT