Detailed information on CNT3092240


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30550259Solanum tuberosumIpomoea triloba96.2793.2198.111057reverse complement

Expression of CNT3092240

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MLSQLFVFHKSKNFTSDYEIRMPPTVPVNHYSDPEGQRNRTEIL*

>peptide 2 (32 aa)
MKYECPRLSLLIITPIPKANVIGPKSYNVIPC*

Sequence

>CNT3092240
AGAACATCTAAGGGCGTCACAAACCTGTTATTGCCTCAAACTTCCGCGGCCTAAAAGGCCGTAGTCCCTCTAAGAAGCTGGCCGCGAAGGGATACCTCCG
CATAGCTAGTTAGCAGGCTGAGGTCTCGTTCGTTAACGGAATTAACCAGACAAATCGCTCCACCAACTAAGAACGGCCATGCACCACCACCCATAGAATC
AAGAAAGAGCTCTCAGTCTGTCAATCCTTACTATGTCTGGACCTGGTAAGTTTCCCCGTGTTGAGTCAAATTAAGCCGCAGGCTCCACTCCTGGTGGTGC
CCTTCCGTCAATTCCTTTAAGTTTCAGCCTTGCGACCATACTCCCCCCGGAACCCAAAAACTTTGATTTCTCATAAGGTGCCGGCGGAGTCCTAAAAGCA
ACATCCGCCGATCCCTGGTCGGCATCGTTTATGGTTGAGACTAGGACGGTATCTGATCGTCTTCGAGCCCCCAACTTTCGTTCTTGATTAATGAAAACAT
CCTTGGCAAATGCTTTCGCAGTTGTTCGTCTTTCATAAATCCAAGAATTTCACCTCTGACTATGAAATACGAATGCCCCCGACTGTCCCTGTTAATCATT
ACTCCGATCCCGAAGGCCAACGTAATAGGACCGAAATCCTATAATGTTATCCCATGCTAATGTATACAGAGCGTAGGCTTGCTTTGAGCACTCTAATTTC
TTCAAAGTAACAGCGCCGGAGGCACGACCCGGCCAATTAAGGCCAGGAGCGCATCGCCGACAGAAGGGACGAGACGACCGGTGCACACCTAGGGCGGACC
GGCCGTACCATCCCAAAGTCCAACTACGAGCTTTTTAACTGCAACAACTTAAATATACGCTATTGGAGCTGGAATTACCGCGGCTGCTGGCACCAGACTT
GCCCTCCAATGGATCCTCGTTAAGGGATTTAGATTGTACTCATTCCAATTACCAGACTCATAGAGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGT
GTCAGGATTGGGTAATTTGCGCGCCTGCTGCCTTCCTTGGATGTGGTAGCCGTTTATCATGATGGTCTACTGTTATTTATTGTCACTACCTCCCCGTG