Detailed information on CNT3075934


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3075934

Peptides detected in this lncRNA

>peptide 1 (69 aa)
MRPPPDCRPSVGASAPKGTCRWLSPFGGSAVRTALNYNYHRAAGRILCRRLKYATGYCKWQSGLAAMIH*

>peptide 2 (62 aa)
MCPPPDCRPSVGASAPKGTCRWLSPFGGSAVRTALNYYYHRAAVRIRARSDACARRPIADPQ*

>peptide 3 (51 aa)
VSNPAAGACVASSPDSDLEAFSHNPAQGSFAPLAFQPSAMTNCANQRFLSY*

>peptide 4 (61 aa)
MCRPSQTPHLTMSSARIDPPKRVLGLKEGVVTLHPIHGVSKITLKVVVFHLRRSSHLFYTS*

>peptide 5 (59 aa)
MNAFTVRIRTENQNQTSFYPFIPHEISVLVELILGHLRYLLTDVPPQPNSTPDNVLRPD*

Sequence

>CNT3075934
GTCAGCAATCCGGCGGCGGGCGCATGCGTCGCTTCTAGCCCAGATTCTGACTTAGAGGCGTTCAGTCATAATCCAGCGCAAGGTAGCTTCGCGCCCTTGG
CTTTTCAACCAAGCGCGATGACCAATTGTGCGAATCAACGGTTCCTCTCGTACTAGGTTGAATTACTATTGCGACGCGGGCATCAATAGGGTAAAACTAA
CCTGTCTCACGACGGTCTAAACCCAGCTCACGTTCCCTATTGGTGGGTGCACAATCCAACACTTGGTGAATTCTGCTTCACAATAATAGGAAGAGCCTAT
ATCGAAGGATCAAAAAGCAACGTCGCTATGAACGCTTTTACAGTTCGTATTCGTACTGAAAATCAGAATCAAACGAGCTTTTACCCTTTTATTCCACACG
AGATTTCTGTTCTCGTTGAGCTCATCTTAGGACACCTGCGTTATCTTTTAACAGATGTGCCGCCCCAGCCAAACTCCACACCTGACAATGTCCTCCGCCC
GGATTGACCCGCCGAAGCGAGTCTTGGGTCTAAAAGAAGGGGTTGTTACCCTGCATCCGATTCACGGAGTAAGTAAAATAACGTTAAAAGTAGTGGTATT
TCACTTGCGCCGGAGCTCCCACTTATTCTACACCTCTTAAGTCATTTCACAAAGTCGGACTAGAGTCAAGCTCAACAGTGTCTTCATTCCCCGCTGATTC
TGCCAAGCCTGTTCCCTTGGCTGTGGTTTCGCTGGATAGTAGACAGGGACACGGGGAAAGAAGACCCTGTTGAGCTTGACTCTAGTCCGACTTTGTGAAA
TGACTTGAGAGGTGTAGAATAAGTGGGAGCTCCGGCGCAAGTGAAATACCACTACTTTTAACGTTATTTTACTTACTCCGTGAACCGGAAGCGGGGTAAC
AACCCCTTCTTTTAGATCCAAGACTCGCTTCGGCGGGTCGATCCGGGCGGAGGACATTGTCAGGTGGGGAGTTTGGCTGGGGCGGCACATCTGTTAAAAG
ATAACGCAGGTGTCCTAAGATGAGCTCAACGAGAACAGAAATCTCGTGTGGAACAAAAGGGTAAAAGCTCGTTTGATTCTGATTTTCAGTACGAATACGA
ACCGTGAAAGCGTGGCCTATCGATCCTTTAGACCTTCGGAATTTGAAGCTAGAGGTGTCAGAAAAGTTACCACAGGGATAACTGGCTTGTGGCAGCCAAG
CGTTCATAGCGACGTTGCTTTTTGATCCTTCGATGTCGGCTCTTCCTATCATTGTGAAGCAGAATTCACCAAGTGTTGGATTGTTCACCCACCAATAGGG
AACGTGATCTGGGTTTAGACCGTCGTGAGACAGGTTAGTTTTACCCTACTGATGCCCGCGTCGCGATAGTAATTCAACCTAGTACGAGAGGAACCGTTGA
TTCGCACAATTGGTCATCGCGCTTGGTTGAAAAGCCAGTGGCGCGAAGCTACCGTGCGCTGGATTATGACTGAACGCCTCTAAGTCAGAATCCGGGCTAG
AAGCGACGCATGTGCCCGCCGCCCGATTGCCGACCCTCAGTAGGAGCTTCGGCTCCCAAAGGCACGTGTCGTTGGCTAAGTCCGTTCGGCGGAAGCGCCG
TTCGGACCGCCTTGAATTATTATTACCACCGAGCGGCGGTCAGAATCCGGGCTAGAAGCGACGCATGCGCCCGCCGCCCGATTGCCGACCCTCAGTAGGA
GCTTCGGCTCCCAAAGGCACGTGTCGTTGGCTAAGTCCGTTCGGCGGAAGCGCCGTTCGGACCGCCTTGAATTATAATTACCACCGAGCGGCGGGTAGAA
TCCTTTGCAGACGACTTAAATACGCGACGGGGTATTGTAAGTGGCAGAGTGGCCTTGCTGCCATGATCCACTGA