Detailed information on CNT3075928


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT3075928

Peptides detected in this lncRNA

>peptide 1 (31 aa)
DPASSHMLVSKIKPCMCKYERIQTVKLRMAH*

>peptide 2 (44 aa)
MTTGRINQVAFINQDKTTSYSRKHMESGNRRRLDRHLLSGDKRA*

>peptide 3 (44 aa)
MHLLDKRSTRALPVALMIHDNSTDRMALVLATHHSNFCPINFRW*

>peptide 4 (55 aa)
MHPFQKSGFVARISSRITTVIRVVVTIKQTITDLMSHSQFHSLNSFILTHAWLNL*

Sequence

>CNT3075928
GATCCTGCCAGTAGTCATATGCTTGTCTCAAAGATTAAGCCATGCATGTGTAAGTATGAACGAATTCAGACTGTGAAACTGCGAATGGCTCATTAAATCA
GTTATAGTTTGTTTGATGGTAACTACTACTCGGATAACCGTAGTAATTCTAGAGCTAATACGTGCAACAAACCCCGACTTCTGGAAGGGATGCATTTATT
AGATAAAAGGTCGACGCGGGCTCTGCCCGTTGCTCTGATGATTCATGATAACTCGACGGATCGCATGGCCTTAGTGCTGGCGACGCATCATTCAAATTTC
TGCCCTATCAACTTTCGATGGTAGGATAGTGGCCTACCATGGTGGTAACGGGTGACGGAGAATTAGGGTTCGATTCCGGAGAGGGAGCCTGAGAAACGGC
TACCACATCCAAGGAAGGCCACTATCCTACCATCGAAAGTTGATAGGGCAGAAATTTGAATGATGCGTCGCCAGCACTAAGGCCATGCGATCCGTCGAGT
TATCATGAATCATCAGAGCAACGGGCAGAGCCCGCGTCGACCTTTTATCTAATAAATGCATCCCTTCCAGAAGTCGGGGTTTGTTGCACGTATTAGCTCT
AGAATTACTACGGTTATCCGAGTAGTAGTTACCATCAAACAAACTATAACTGATTTAATGAGCCATTCGCAGTTTCACAGTCTGAATTCGTTCATACTTA
CACATGCATGGCTTAATCTTTGAGACAAGCATATGACTACTGGCAGGATCAACCAGGTAGCATTCATAAATCAGGACAAGACCACGTCATATTCCCGCAA
ACACATGGAAAGTGGGAACAGACGCAGACTTGACCGTCATCTTTTGTCCGGAGACAAACGTGCTTAGCGGGAC