Detailed information on CNT30724991


BLAST search results

BLAST vs Swiss-Prot:
sp|P09672|G3PA_SINAL, E-value = 8e-68

BLAST vs NONCODE:
NONMTRT001777, E-value = 2e-101

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30515727Lupinus angustifoliusJuglans regia3.0425.2785.9271forward
CNT30372815Lupinus angustifoliusArabidopsis thaliana32587.1470forward
CNT30268339Lupinus angustifoliusChenopodium quinoa14.2340.7982.23332forward
CNT30729008Lupinus angustifoliusCorchorus capsularis10.5446.1583.33246forward
CNT30381182Lupinus angustifoliusManihot esculenta9.9458.4483.62232forward
CNT30524759Lupinus angustifoliusPhaseolus vulgaris16.832.0587.5392forward
CNT30628637Lupinus angustifoliusVigna unguiculata10.6729.0588.76249forward
CNT30712687Lupinus angustifoliusGlycine max16.8548.2287.28393forward
CNT30146657Lupinus angustifoliusMedicago truncatula16.0334.0989.57374forward
CNT30310642Lupinus angustifoliusCamelina sativa16.7259.7280.77390forward
CNT30598889Lupinus angustifoliusFraxinus excelsior3.8138.283.1589forward
CNT30215929Lupinus angustifoliusHelianthus annuus8.5321.182.91199forward
CNT30622203Lupinus angustifoliusCajanus cajan16.845.5385.46392forward
CNT30119382Lupinus angustifoliusCitrus clementina8.9622.9982.78209forward
CNT30330803Lupinus angustifoliusDioscorea rotundata5.8322.0181.62136forward

Expression of CNT30724991

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MYISSLPFSEIQLVFRRIMVARIELKHYILEALYYHIMNQFSPKCLFKCFLITK*

>peptide 2 (69 aa)
MTFPSTEIPLSPTGLTSASKIPRSPYDRASTSRNSFQSYQIRLWPPSVLLLLHLSCTLRCFQPSKFKQM*

>peptide 3 (37 aa)
MQMKKKERGLQGAHIRWTCRPIASTFIFRGKNFFTQM*

>peptide 4 (35 aa)
MENEGFRVMKYTYKMILKPSISLHFPTKFNSQTDS*

>peptide 5 (31 aa)
MCFPAPSLSTNTPVPSITKSIPKSLQHPNTH*

>peptide 6 (30 aa)
MERYIINKLVCFVGSLPIVSNNVSQIHNPL*

>peptide 7 (30 aa)
MEETQHAVMHQVMIMYSWVKDQVYQNLKLM*

Sequence

>CNT30724991
CAATGAATTTGTAACTCATGCAAATGAAGAAAAAAGAACGTGGATTGCAAGGTGCACATATACGATGGACTTGTAGGCCTATAGCATCAACATTCATATT
TAGAGGTAAGAATTTTTTTACACAAATGTGAAGCATAGAGAAAGTTGATTGATTGGTTCTATTTCTCAGTACAAGTTTCCAAAGTAAAATGAAAAATGGG
GCAAGAAATTTAGTAAGCATACAAAACCATAATGGAAAGGTACATAATTAACAAATTGGTTTGTTTTGTTGGCTCACTTCCAATTGTTAGCAACAATGTC
AGCCAAATCCACAACCCTTTGTGAGTAACCCCACTCATTATCATACCAAGCAATCACCTTCACAAAATCATCTCCCATTACCATTGTCAATGATGAGTCA
ATAGTTGAGGACACATCAGTGCACCTAAAATCTACTGACACAAGTGGCTCATCACAAACTGAGAGAATACCATTCAGCTCCTTATCTGCACTCTCTCTGA
AAGCTGCATTCACTTCTTCTGCGAAAGTCTTTTTCGAGACTTGAACAACAAGGTCTACAACTGAGACGTTTGGCGTTGGGACACGGAGTGCGATTCCGTT
GAGCTTGCCTTTGAGGGATGGGAGGACTAGGGCCACAGCCTTGGCTGCTCCTGTTGAAGTTGGGATGTCTCCTTTGCCAGGTGCTGTGATTAGTACCTTC
TTAGCACCTGCTTGAATGTGTTTCCCTGCACCTTCTCTGTCCACAAACACCCCAGTTCCTTCGATCACCAAGTCGATCCCTAAGTCCCTGCAACACCCGA
ACACACATTAGTGCATATTATTTCTCTTCTCTGTATTCCATATTCTTCAAAGTTGAGAAAATTGGTTGCAATGCTGCAAAGAACTTTCAGGTCCGTTTGC
GAGCGAGTTGAGTTTTAAAGGGGAAGGAATGGAAAATGAAGGTTTTAGAGTCATGAAATACACTTATAAGATGATTCTAAAGCCTTCAATTTCCCTTCAT
TTCCCTACAAAATTCAACTCGCAAACGGATTCTTAAGTACCATTTGGTGCATAGACAAAAAACAGGACTGAACAAGAATAACTTAAGGTACCATTTGGTG
CATATACAAAATAGGACTGAACAAGATGTTTTGTTCTATTCTCTTTGGTTCCACCTCTTTCCGTGGAATTAAAATGTACTGTTTTTTAACTTCATGTTAT
GTTCTGTTCTAATTACAAAACACAACAAACATAGGGTACAACAAATGTTCTGTTGCATCCTATTATGACATGATTATGAAGCTTACTTCCAGGGGAGGTT
TGCAGGGTTACGATCAGAAACAACTTTGATGACCTTTCCATCAACAGAAATACCATTATCACCAACAGGCTTGACATCGGCGTCGAAAATTCCAAGAAGT
CCTTACGACCGTGCCAGCACCTCAAGAAATTCCTTCCAATCCTACCAAATCCGTTTATGGCCACCTTCAGTTTTGCTTCTACTACACCTTTCTTGTACCC
TCCGGTGCTTCCAACCTTCAAAATTTAAACAAATGTAATGTTGTTAAACAGATCATTAAATATTTAAAGTCATGAGTTCAAATCGTGGAAACAGTCTATC
TGCTTGTCGAGGTAAGGCTGCATATATCTACCATCCCAGACCACACTAAGTGGGAGCCTCGTGCACTGGTCCACCTACTTTTAGGCATTGTGAAAGGCCT
AGTTCAAACACTAATATAACTAGTTCACCATGGATGGAAGAAACGCAGCATGCAGTCATGCACCAAGTGATGATAATGTACTCATGGGTCAAGGACCAAG
TCTATCAAAACCTTAAGCTAATGTAAGGTGAAGGCTCATGATTACTTTTATATTAGCCATGCTGCAATATGCATAAGAGTCATTTATAGTTTATACCTGA
ATATTGGATATGTACATATCATCTTTACCATTTTCTGAAATTCAACTTGTATTTAGAAGAATAATGGTAGCAAGGATTGAACTCAAACATTACATTCTAG
AGGCTCTATACTATCATATTATGAACCAATTCTCTCCAAAATGTTTATTTAAATGTTTTTTAATTACAAAATAATTTATACTGCAATGGCACTGCAACTG
TGACCGCAATCAAAACCATACCCCCAATTTAAAAATTGAATGTGATATAAGATATTAATAACCACTTGATATGTCAAATATTGAATCTAAAGGACTTCGT
CTAATTGTCTTTACATAACTTCGGGTGCATACATTATTGTTCAACATAAGATCATTCATAAAAGTCAATAACTGAACCATTTTAAAATGTTAGCCCTTGT
ATTTAGCGATTATTTATGATCATTTTTTTAGTA