Detailed information on CNT30710830


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 2e-96

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30710830

Peptides detected in this lncRNA

>peptide 1 (74 aa)
STPGEEAPKGPFPIRPPTGTRRPALAAEAARAVHRQPTGSGLGPPCPALRANPFPEVTDPFCRLPLPTLFHRPEA

>peptide 2 (74 aa)
FDARGRGPEGPVPNPSPDRHATTRSRRGSSSSSPPTADGFGTGTPVPSPQSQSFSRGYGSILPTSLAYIVPSTRG

>peptide 3 (73 aa)
RRPGKRPRRARSQSVPRPARDDPLSPRKQLEQSTDSRRVRDWDPRAQPSEPILFPRLRIHFADFPCLHCSIDQR

Sequence

>CNT30710830
TTCGACGCCCGGGGAAGAGGCCCCGAAGGGCCCGTTCCCAATCCGTCCCCCGACCGGCACGCGACGACCCGCTCTCGCCGCGGAAGCAGCTCGAGCAGTC
CACCGACAGCCGACGGGTTCGGGACTGGGACCCCCGTGCCCAGCCCTCAGAGCCAATCCTTTTCCCGAGGTTACGGATCCATTTTGCCGACTTCCCTTGC
CTACATTGTTCCATCGACCAGAGGCT