Detailed information on CNT30694291


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30556104Oryza sativaOryza glaberrima54.357.594.43341forward
CNT30102182Oryza sativaOryza rufipogon101.2783.2598.74636forward

Expression of CNT30694291

Peptides detected in this lncRNA

>peptide 1 (62 aa)
EPTEEVSQLERQPATAAPQRARSPRRQQAIPSPWAGTQQWRTLVAGAALCGDQCLLCWGERR*

>peptide 2 (53 aa)
MPSMPATARPMRVCGGRAREGAARQLGDPPMDPSDEDRYFPTHRLPEYLKNHP*

>peptide 3 (69 aa)
RAHRGSQPARAAAGDGGASASTEPTAAAGHPLTVGWHTAVAHARRRCCSLRRPMLALLGRAPVRTWRLV*

>peptide 4 (33 aa)
MWRPRSRGSGAAARRSTNGSERRGSLLPYTPAS*

>peptide 5 (35 aa)
MAAGVVGRRGCPLCRRQRGPCEYVAAALERERRGS*

Sequence

>CNT30694291
AGAGCCCACCGAGGAAGTCAGCCAGCTAGAGCGGCAGCCGGCGACGGCGGCGCCTCAGCGAGCACGGAGCCCACGGCGGCAGCAGGCCATCCCCTCACCG
TGGGCTGGCACACAGCAGTGGCGCACGCTCGTCGCCGGTGCTGCTCTCTGCGGCGACCAATGCTTGCTCTGCTGGGGCGAGCGCCGGTGAGGACATGGCG
GCTGGTGTAGTAGGCCGGCGGGGATGCCCTCTATGCCGGCGACAGCGAGGCCCATGCGAGTATGTGGCGGCCGCGCTCGAGAGGGAGCGGCGCGGCAGCT
AGGAGATCCACCAATGGATCCGAGCGACGAGGATCGTTACTTCCCTACACACCGGCTTCCTGAGTATCTGAAGAATCATCCCTGAGAGACTACAGGGACG
TGCTGGGAGAACCGTCCTCCATTACCAGAAGATTGTTGAGTCGTCGTCAAGCTGCAAGCATTGCTAACTGCTAGAGCAGCTACCTACTGGCTACTGCGTT
ACGTGTACGTGTACCGCAGGATAGATTTGTAATGTTGTTTTCAGATACTCCGGATTATTTGACAGGAAGGATTAATAGCTTATTACTGCATAATACCGCA
CCGAAGATGTTATAAAATTAAAGCTGAC