Detailed information on CNT30693571


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553835Oryza sativaOryza glaberrima10041.994.2414forward
CNT30370190Oryza sativaOryza glumipatula52.6636.7100218forward
CNT30604154Oryza sativaOryza punctata21.019.4487.3687forward

Expression of CNT30693571

Peptides detected in this lncRNA

>peptide 1 (49 aa)
LVQNSDAVLARLAGNGDPVRQGTSKVCGQQDETIVALCTDSIFEGTALI*

Sequence

>CNT30693571
TACTCGTTCAGAATTCAGATGCAGTGTTGGCGCGGCTAGCAGGCAACGGTGATCCTGTGCGGCAAGGGACGAGCAAAGTTTGTGGGCAGCAGGATGAAAC
AATAGTGGCCTTGTGCACTGATAGTATTTTTGAAGGGACTGCACTGATATGATAGTATTGATATTGTGATACGACGCCAGTACGCCACGAGATAGATTAA
AATCCAGATATCTGCATCTTAAAATCCAGATATCTGCATCGTGGGTGTTGCCGTGCACCCTCTGATTCTTTGATTCTGTCATCTAAATTGTAAAAAGCGG
CTACATATCCCTCCATTTCTTTCCTCTCTGTACACTCGTAAGCATCCAAAATACAAAGGTTTGGCCTATTGCGTTGTCAAATTGAGAAATTAGTCAACTC
TACAATTTGAAATC