Detailed information on CNT30676339


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30132936Setaria viridisLolium perenne21.369.6486.92107forward
CNT30339804Setaria viridisEragrostis tef10048.2285.43501forward
CNT30603977Setaria viridisOryza punctata62.2877.6179.49312forward
CNT30558445Setaria viridisPanicum hallii67.6657.3695.58339forward

Expression of CNT30676339

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MRWAPQTIHHSHWRPRAKPKFSRISIAHGECMAFWYRG*

>peptide 2 (42 aa)
MANAWPFGTGDRLLVLGAKRSSDTILPREQLVSLVEGSSLCK*

>peptide 3 (43 aa)
MHGLLVQGIGSSFLEQRDLQIPFFHVNNWFHSLKVRRYANDVL*

>peptide 4 (53 aa)
MQEEVGRNSEMMEEASKNCGLEEEASKQQNLEEEVRDEVGSSNHPSFSLATSG*

>peptide 5 (31 aa)
MQMMFSDTRHRNVKELLMVPWHATRHDMLVFI

Sequence

>CNT30676339
CTGTTAAACCCAAGGTAAACCTGGCCAAATGTACCACTGCCTAGCAATTTCCCTTTTTTCCATTGTGATTGGGACTGTGAGCAAGTAGTGGGAGATGCAG
GAAGAGGTGGGCAGGAACTCGGAGATGATGGAAGAGGCGAGCAAGAACTGTGGTTTGGAGGAAGAGGCGAGCAAGCAGCAGAACCTGGAGGAAGAGGTAA
GGGATGAGGTGGGCTCCTCAAACCATCCATCATTCTCACTGGCGACCTCGGGCTAAACCCAAATTCTCTAGAATTTCCATTGCTCATGGCGAATGCATGG
CCTTTTGGTACAGGGGATAGGCTCCTCGTTCTTGGAGCAAAGAGATCTTCAGATACCATTCTTCCACGTGAACAACTGGTTTCACTCGTTGAAGGTTCGT
CGCTATGCAAATGATGTTCTCTGACACTAGACACAGGAATGTCAAAGAACTTCTGATGGTCCCGTGGCATGCTACAAGACATGACATGCTTGTCTTCATT
T