Detailed information on CNT30675769


BLAST search results

BLAST vs Swiss-Prot:
sp|P27787|FER1_MAIZE, E-value = 1e-37

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695489Setaria viridisOryza sativa34.4129.0491.12214forward
CNT30523690Setaria viridisSetaria italica62.2252.02100387forward
CNT30307945Setaria viridisTriticum aestivum30.5529.9792.63190forward
CNT30398830Setaria viridisTriticum turgidum30.5526.3292.11190forward
CNT30670012Setaria viridisTriticum dicoccoides30.5527.9892.11190forward
CNT3011815Setaria viridisZea mays33.7625.0988.57210forward
CNT30683972Setaria viridisTriticum urartu30.5527.5892.11190forward
CNT30596741Setaria viridisOryza meridionalis34.4126.5591.59214forward
CNT30370929Setaria viridisOryza glumipatula34.4127.991.12214forward
CNT30103152Setaria viridisOryza rufipogon34.4125.6691.12214forward
CNT30584428Setaria viridisEchinochloa crusgalli33.620.0893.78209forward
CNT30117400Setaria viridisOryza nivara34.4124.6891.12214forward

Expression of CNT30675769

Peptides detected in this lncRNA

>peptide 1 (49 aa)
YIVYICIGCTKIKRKNVINYLSEAYHASAVKMNDTETSNKQSNKRWRSC*

>peptide 2 (29 aa)
MHDTRKGIVRRRQTRSLARARQILDIASA*

Sequence

>CNT30675769
TATATATAGTATATATATGTATTGGTTGTACAAAAATAAAGAGGAAAAACGTTATTAATTACTTGAGCGAAGCCTATCATGCATCCGCAGTAAAAATGAA
TGATACAGAGACCAGCAATAAGCAGAGTAACAAACGATGGAGAAGCTGCTGATGCCGATGCTTAATTGCAAGGTCTCATGGTGACACTGACATGCATGAT
ACAAGAAAGGGAATTGTCCGGCGTCGTCAAACTCGATCTCTTGCAAGAGCAAGACAGATACTAGATATAGCAAGCGCGTAGCAGGTAGTGATCGAGCTTC
TTAGATGAGCTCCTCCTCCTTGTGCGTCTCGATGACGACGTCGGAGGTGGGGTAGGCGTGGCAGGTGAGCACCCACCCGGCGGCGACCTGGCCGTCGTCG
AGGAAGCTCTGGTCGGACTGGTCGATCCCATCCTCCTCGGCCTGGTCGAGGATGTAGACGTCGTCGGGCACCTGGAGCTCCACCTCGCCGTCGGGGGTGA
TGAGCTTGACGTTGGCGGTGGCCATTATTGTGCTTTGTGGTTGCTAGGTAGCTGCAGCAGCTGAAGCAATGGAAGAATCGGCCACACACACCTAGGGATT
AGGGAAGGAATGAAGGAGCAAT