Detailed information on CNT3067041


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694227Leersia perrieriOryza sativa20.2711.1582.19320reverse complement
CNT30553992Leersia perrieriOryza glaberrima20.2734.1581.88320reverse complement
CNT30102228Leersia perrieriOryza rufipogon20.277.7882.5320forward
CNT30116895Leersia perrieriOryza nivara20.278.0182.5320reverse complement
CNT30604208Leersia perrieriOryza punctata20.3312.5581.93321forward

Expression of CNT3067041

Peptides detected in this lncRNA

>peptide 1 (63 aa)
RRRSVPRRRRLFLISPFLSKSPLSLSRRAAAAARGAHTQAMALRGGSRGRRREHAAHRWVTSA*

>peptide 2 (40 aa)
MYISFVFNYVLSKSVLSFLWLYSMNLILFFFLFGDKFIIE*

>peptide 3 (37 aa)
MRGKFVCCLSIRSNGVADYLCIWPDEQYKTNGITHMT*

>peptide 4 (34 aa)
MPKITVLPEALEKYSQDVTRKLLPNTYRREPYKT*

>peptide 5 (59 aa)
AAAPSLAAAASSSSRPSSPNLPSPSHGVRRRLREARTPKRWRSAAGREGDDASMPHIGG*

>peptide 6 (67 aa)
MCHFERPATGKGEAVTRATRCFANSFSSSPLKATIRHAHSRATFPLQMRWWSSASCQHCHAQDHSSS*

>peptide 7 (64 aa)
MYAPEHTGLQFCLVNFKVNQYFVVHTFIGFCESILFFFYFLNGCDELMTGETAPWRSFVILVPW*

>peptide 8 (85 aa)
MRPCSPTSYQLQLFVVSTCYNEWFYLSVSCRVTEGVLTCCRLAVTRAFVTLGIDNYINLSHSCTFPLFSTMFYPNQSLVSYGCTL*

>peptide 9 (57 aa)
PPPLRPSPPPPLPHLALPLQISPLPLTACGGGCARRAHPSDGAPRRVARETTRACRT*

>peptide 10 (57 aa)
MFCQQLFLFSPKSNHPPRPQSSHLSVADEMVVIGLLSTLPCPRSQFFLKHLRNIPRM*

Sequence

>CNT3067041
CCGCCGCCGCTCCGTCCCTCGCCGCCGCCGCCTCTTCCTCATCTCGCCCTTCCTCTCCAAATCTCCCCTCTCCCTCTCACGGCGTGCGGCGGCGGCTGCG
CGAGGCGCGCACACCCAAGCGATGGCGCTCCGCGGCGGGTCGCGAGGGAGACGACGCGAGCATGCCGCACATAGGTGGGTGACCTCCGCGTGAGATCCAG
TCGTGCCCGGTATGTGTCACTTCGAGCGGCCGGCAACAGGAAAGGGCGAGGCAGTGACCCGTGCCACGCGATGTTTTGCCAACAGCTTTTCCTCTTCTCC
CCTAAAAGCAACCATCCGCCACGCCCACAGTCGAGCCACCTTTCCGTTGCAGATGAGATGGTGGTCATCGGCCTCTTGTCAACACTGCCATGCCCAAGAT
CACAGTTCTTCCTGAAGCACTTGAGAAATATTCCCAGGATGTAACGAGGAAATTACTTCCAAACACATATAGGAGAGAACCTTACAAAACTTGAATCCCT
GGAAGCCAATAGTATGCGTGGCAAATTTGTGTGTTGTCTTTCCATAAGGTCAAATGGAGTGGCCGACTATCTCTGTATATGGCCTGATGAACAGTACAAA
ACAAATGGAATTACGCATATGACCTAATGAACAGTACAAAACAAATGGAATTACGCTCTTACATGGCTCCATCTTTGCAACCAAAGATTGAGTGAAATAG
TAACAGGAGGGCTAAAAACAGATCAGTGGTTAATTAACATTCTTTTTGTCTGGACACTTTGGAAAGTATGTATGCCCCTGAGCATACTGGACTGCAATTT
TGTTTGGTTAACTTTAAAGTGAATCAGTATTTTGTCGTTCATACTTTCATAGGCTTTTGTGAATCAATTTTGTTTTTTTTTTATTTCTTGAATGGCTGTG
ATGAACTGATGACCGGTGAGACTGCCCCTTGGAGGTCATTTGTTATCTTGGTTCCTTGGTAACATGTTCAGTTAGCTGCCGTATTATGAGGCCTTGCTCC
CCAACAAGTTACCAATTGCAACTGTTTGTTGTTAGTACATGCTATAATGAATGGTTCTACTTATCCGTTTCATGTAGAGTGACGGAGGGAGTACTCACAT
GTTGCCGCCTTGCCGTAACCAGGGCATTTGTAACGTTGGGAATTGATAATTACATTAATCTGAGCCATTCATGTACATTTCCTTTGTTTTCAACTATGTT
TTATCCAAATCAGTCCTTAGTTTCTTATGGTTGTACTCTATGAATCTGATTCTGTTTTTTTTCCTGTTTGGTGATAAATTTATAATAGAGTGAATTTCAC
AAATCTCCAGCTATTGAGGCTTTCATAACACAAAACTATGTTTTGTGATTTGTTTCATAGAACCCCTTGTTTTGGGGGCAAAGTGTTAAAAAAACCATAA
TTACATGAAATACTAATATTTCAATACTATACATAAGTATTTTTTTTACACAAATTCACATTAGATTATTCAAAAATACACACCACTCGTTCACTTTATT
ATTTCTCAATTTTATACCTGCTGCTGCTCGTCAGCTCGATCAGACCCCCTGCGGCTTGGTCTCGGTTCATGTTCCTCCC