Detailed information on CNT30596741


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0J8M2|FER1_ORYSJ, E-value = 1e-37

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695489Oryza meridionalisOryza sativa80.6588.293.85650forward
CNT30675769Oryza meridionalisSetaria viridis26.5534.4191.59214forward
CNT30523259Oryza meridionalisSetaria italica15.2623.2592.68123forward
CNT30307945Oryza meridionalisTriticum aestivum26.4333.691.55213forward
CNT30398830Oryza meridionalisTriticum turgidum26.4329.591.08213forward
CNT30442884Oryza meridionalisAegilops tauschii14.1423.2294.74114forward
CNT30248543Oryza meridionalisAvena sativa13.6528.890.91110forward
CNT30670012Oryza meridionalisTriticum dicoccoides26.331.2291.04212forward
CNT30469592Oryza meridionalisSaccharum spontaneum14.7625.9388.24119forward
CNT3011815Oryza meridionalisZea mays27.326.2887.73220forward
CNT30683972Oryza meridionalisTriticum urartu26.4330.9191.08213forward
CNT30370929Oryza meridionalisOryza glumipatula80.6584.7593.85650forward
CNT30103152Oryza meridionalisOryza rufipogon80.6577.9493.85650forward
CNT30584428Oryza meridionalisEchinochloa crusgalli26.4320.4692.96213forward
CNT30117338Oryza meridionalisOryza nivara80.6583.5593.54650forward
CNT30594952Oryza meridionalisEragrostis curvula13.921.2992.86112forward

Expression of CNT30596741

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MEYVFDSSMHAYIYIYIYMTPKCDMNMIN*

>peptide 2 (71 aa)
MYTSSGTCSSTSPSGVISFTLYVACIRSLSPSLLLAGSTDTRAGAGAAATRRDMGNRTWLLSAVAAMAIAN*

>peptide 3 (38 aa)
MSRYKSRTRIYSLLIVLSNTWSTYLTVVCMHIYIYIYI*

Sequence

>CNT30596741
AATTAATTCAGTACGAAACACATGAGTAGATACAAGAGTAGAACTAGGATATATAGCTTATTAATTGTTCTTTCAAATACATGGAGTACGTATTTGACAG
TAGTATGCATGCATATATATATATATATATATATATGACACCAAAATGTGATATGAATATGATTAATTAAGCAGCTGCAGCAAAACGTACATTAATTAAA
CAACAATAATTAACCCTCGGGCACGCCTGTGTTTTGTTATCTCGCTCAACATATACGTACGTAGTACTTTGCTTGCATAGGGACGACGACATTATATTCT
TAATTGATAAACTCAAGAACGCATGGAGATCGATCGATCGATCGAGAGATTTATAAATATGGAGCTTGCTTGATTGATTGATTAGATGAGGTCGTCCTCC
TTGTGGGTCTCGATGACGACGTCGGACTTGGGGTAGGCGTGGCAGGTGAGGACCCAGCCGGCGGCCACCTGGTCGTCGTCGAGGAAGCTCTGGTCGGACT
GGTCGATCCCTTCCTCCTCCGCCTGGTCCAGGATGTACACGTCGTCCGGCACCTGCAGCTCCACCTCGCCATCGGGGGTGATCAGCTTCACGTTGTACGT
CGCCTGCATCCGCAGCCTCTCCCCGAGCTTGCTGCTCGCCGGCAGCACCGACACGCGCGCCGGCGCCGGAGCCGCCGCCACCCGCAGGGACATGGGCAAC
CGGACCTGGCTGCTCAGTGCCGTCGCCGCCATGGCTATAGCTAATTAAGCTAGCTAGCTGCTGCTGCTAGGTAAGGTAGAGGAGGAGGAGGAGAGGTCGT
CGCAAA