Detailed information on CNT30595947


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369763Oryza meridionalisOryza glumipatula76.8591.0798551forward
CNT30100799Oryza meridionalisOryza rufipogon76.9930.5898.19552forward
CNT30575483Oryza meridionalisOryza barthii71.5552.497.86513forward

Expression of CNT30595947

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MLLVTLLIQLSDKQAKATLLNWLASCSSGSGINHANLKQLS*

>peptide 2 (42 aa)
TSHMLILSVQQNKLRVLLCNNNRPSFIFSHGLALPWKEYTLT*

>peptide 3 (52 aa)
YITYVDFKCPTKQATSTFMQQQQTIIHIQPRFSFTVEGVHTYIIHNDLDQSY*

>peptide 4 (89 aa)
MSFFLRWRGRGPAATCARGRRGGSATGTWAWTASTERGEKRNLDSPWSAPVRRRIMCWCAGGPWNHHSRSGASSSCALRASPELSASYSR

>peptide 5 (37 aa)
MARTRPGSDLCARSARRLCHRHLGLDGVDGARGEEEP*

Sequence

>CNT30595947
GTACATCACATATGTTGATTTTAAGTGTCCAACAAAACAAGCTACGAGTACTTTTATGCAACAACAACAGACCATCATTCATATTCAGCCACGGTTTAGC
TTTACCGTGGAAGGAGTACACACTTACATAATCCATAATGACTTGGACCAAAGCTACTGATGCTACTGGTCACACTGCTGATTCAGCTTTCAGACAAGCA
AGCAAAAGCAACACTACTTAACTGGCTGGCTAGTTGCAGTAGTGGTAGTGGGATTAATCACGCAAACCTGAAGCAGCTCAGTTGAGCTGAGCGGCTTTAG
CCCATAAGCAATAAACTATAGCTAGTGACTTCACTCAGTGCGTGCGCTTCCGTTTTTATTTATTTAGCTAATCACTATTGATAAGTATCGCTTGATTTTT
TTTATATGTGATTAATTTAGGGAAGCTTTTTGCGCCTTGAGTTCTTGATGTCTTTTTTTCTTAGATGGCGAGGACGAGGCCCGGCAGCGACTTGTGCGCG
CGGTCGGCGCGGCGGCTCTGCCACAGGCACTTGGGCTTGGACGGCGTCGACGGAGCGAGGGGAGAAGAGGAACCTTGACTCGCCGTGGTCGGCGCCGGTG
AGGAGGCGCATCATGTGCTGGTGCGCCGGCGGCCCATGGAACCACCACTCGAGGTCCGGCGCGAGCAGCTCCTGCGCCCTGCGCGCGTCCCCGGAGTTGA
GCGCCTCGTACAGCCGC