Detailed information on CNT30576783


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30185403Oryza barthiiSecale cereale15.3335.6692.3992forward
CNT30222305Oryza barthiiHordeum vulgare38.6717.3888.36232forward
CNT30227586Oryza barthiiAnanas comosus12.8321.3392.2177forward
CNT30721105Oryza barthiiTriticum spelta35.1710089.1211forward
CNT30434598Oryza barthiiPapaver somniferum5287.8982.69312forward

Expression of CNT30576783

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MTDRSIYSKTPPLSYIPYITLDRYHIHGI*

>peptide 2 (63 aa)
MHLFGLLLNREIGLYIFLILIHIRCPTNNANRSYLMSDSGLYDRSIDILQDSTFVIYSIYHIR*

Sequence

>CNT30576783
CTCATCTTTAAAAACCGATGCGAATGTAGTCCTAAGATAGTATTGAAGGTGGCTTTGCCCTTACATTCTATTTAGGATTAGAAATAGGTGTAATCAGACC
TACTTTTGACATATCTATCCTATCCTTATTTGGGTATCATATGCATCTCTTTGGGCTTCTATTGAATCGAGAAATTGGATTGTACATCTTTTTGATTTTG
ATACATATAAGGTGTCCTACGAATAATGCAAATCGAAGCTATTTGATGTCTGACTCAGGCCTATATGACCGATCGATCGATATACTCCAAGACTCCACCT
TTGTCATATATTCCATATATCACATTAGATAGATATCATATTCATGGAATATGATTCACTTTTAAGATGCTTTGATGGTGAAATGGTAGACACATGAGAC
TGAAAATCTCGTGCTAAAGAACGTGGAGGTTCGAGTCCTCTTCAAGGCATAATACGGAGAATGCTCGTAACGTGGTACAAGAAAGAAAAATAAAAAACCA
TAAGGAATATATTGTATCATGTTTTACAGTTTAAGGATATGACTTAAACTCGACGTTAAAGATGAGAGACCGAAAGTGAACTTATTTGTTTGCTCACTCC