Detailed information on CNT30576715


BLAST search results

BLAST vs Swiss-Prot:
sp|P14947|MPAL2_LOLPR, E-value = 1e-12

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30576715

Peptides detected in this lncRNA

>peptide 1 (60 aa)
VVDDTVAAVLDKEADGKGALERRLTLERPGVSRRLLERHPVLAALLLDLHLRDGDVGDEL*

>peptide 2 (60 aa)
MATLVTSSRLFPLEPSPTLKVTSVAHEPTTNNAATATASRKEDNEAIGELASLLVLSFLFL

Sequence

>CNT30576715
GTCGTCGACGACACGGTAGCCGCAGTTCTTGACAAGGAAGCGGACGGAAAAGGGGCCCTTGAGCGCCGCCTCACTCTTGAGCGACCAGGTGTTAGTCGAC
GACTCCTTGAGCGCCACCCAGTCCTTGCCGCCCTTCTCCTTGATCTCCACCTCAGAGATGGCGACGTTGGTGACGAGCTCTAGACTTTTTCCGCTAGAGC
CCTCACCGACCTTGAAGGTGACCTCAGTGGCGCATGAGCCAACGACCAACAATGCCGCCACTGCCACGGCGAGCCGGAAGGAGGACAACGAGGCCATTGG
CGAGCTAGCTAGTTTGTTGGTGTTGTCTTTCTTGTTTCTTGA