Detailed information on CNT30576596


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005789, E-value = 0.0

Expression of CNT30576596

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MTKEPGALIPSGFVLRDSSCLAWKRPLYFHIAMLGP*

>peptide 2 (55 aa)
GSQIFKGIKRSEVLISSSRNTTLQFVGKFTGAMRISPVSTNRICCMRHATTVSSF*

>peptide 3 (60 aa)
MPLLSRVFDSLYDKRTRSIDPIRVCFERFLLSCMEATVVLSHCNVRPLILAVAVTKKDDH*

Sequence

>CNT30576596
GGCTCTCAAATCTTCAAGGGAATCAAGAGATCAGAGGTTTTGATTTCAAGTAGTAGAAACACAACTCTCCAATTCGTCGGAAAATTCACCGGTGCGATGC
GAATCTCACCTGTCTCCACCAATCGTATTTGCTGCATGCGACATGCCACTACTGTCTCGAGTTTTTGACTCGCTCTATGACAAAAGAACCAGGAGCATTG
ATCCCATCCGGGTTTGTTTTGAGAGATTCCTCTTGTCTTGCATGGAAGCGACCGTTGTACTTTCACATTGCAATGTTAGGCCCTTAATTCTTGCTGTTGC
TGTTACAAAAAAAGATGATCATTGAGTAGGAGTACTTACAATCCCAATTACCCATTTGTATATCTATCATTATTCTCTTAACGGTACCTTATCGTTTGAT
GATGATATTATACACTGGTGTTGACATCTGTTTGATGTTCACCTTAACCAAGAGTAGATTTTTTGGGGTACATATATAGAAGAATCGTTTATTTTGTCTA
TATTGGACTGTTGATGTTGGACTGTTTAATTAGTTCAACATAATATATGTCATACTTTTGTAATGGAGTAGGAAAGCTAACGGGCTCCTTAAAATTTAAG
ATGCCACATGGCCCC