Detailed information on CNT30575849


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692204Oryza barthiiOryza sativa98.2146.7799.27275forward
CNT30552942Oryza barthiiOryza glaberrima94.6452.27100265forward

Expression of CNT30575849

Peptides detected in this lncRNA

>peptide 1 (66 aa)
MANQIHPKGDNQECCRNVGNAPDWQEELWDHDRHRDDNIVENKGNSRGNNSPHQEEAIQHVDLLQG*

>peptide 2 (32 aa)
MDMTLSNKIHSGTVCRFLERKDSYGKSNSSKR*

Sequence

>CNT30575849
GCATGGACATGACGCTCTCGAATAAAATCCACAGTGGCACTGTGTGCAGATTTCTGGAGCGAAAAGACAGTTATGGCAAATCAAATTCATCCAAAAGGTG
ACAATCAGGAGTGCTGTAGGAATGTAGGCAACGCCCCAGATTGGCAGGAAGAGCTCTGGGATCATGACCGACACAGGGATGATAACATTGTAGAGAATAA
AGGCAACAGCAGGGGCAACAACTCTCCTCACCAGGAAGAAGCTATACAGCATGTAGATCTTCTTCAAGGATGACACTTTC