Detailed information on CNT30572709


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675831Vitis viniferaSetaria viridis27.0314.7393.7580forward
CNT30523531Vitis viniferaSetaria italica27.0311.6693.7580forward
CNT30533222Vitis viniferaEucalyptus grandis27.725.2397.5682forward
CNT30318276Vitis viniferaCorylus avellana27.77.9596.3482forward
CNT30547713Vitis viniferaIpomoea triloba26.699.2110079forward
CNT30514313Vitis viniferaJuglans regia28.0422.1997.5983forward
CNT30701463Vitis viniferaQuercus lobata28.3816.2897.6284forward
CNT30376000Vitis viniferaArabidopsis thaliana27.721.9392.6882forward
CNT30500546Vitis viniferaCoffea canephora27.3617.4995.0681forward
CNT30278460Vitis viniferaChenopodium quinoa28.7213.6796.4785forward
CNT3070099Vitis viniferaQuercus suber28.3815.0897.6284forward
CNT30404042Vitis viniferaBeta vulgaris29.3918.1296.5587forward
CNT30524689Vitis viniferaPhaseolus vulgaris28.0418.2496.3983forward
CNT30628518Vitis viniferaVigna unguiculata28.728.4596.4785forward
CNT30195551Vitis viniferaPisum sativum28.0416.0995.1883forward
CNT30494259Vitis viniferaOlea europaea27.3616.0797.5381forward
CNT30506885Vitis viniferaNicotiana attenuata27.715.1397.5682forward
CNT30712442Vitis viniferaGlycine max28.725.0798.8285forward
CNT3043428Vitis viniferaPrunus dulcis26.3517.4196.1578forward
CNT30163346Vitis viniferaPistacia vera26.6911.9397.4779forward
CNT30638745Vitis viniferaCapsicum annuum28.0416.3196.3983forward
CNT3094527Vitis viniferaSolanum tuberosum28.0415.996.3983forward
CNT30307634Vitis viniferaTriticum aestivum28.0412.9993.9883forward
CNT30399552Vitis viniferaTriticum turgidum28.0413.0593.9883forward
CNT30561111Vitis viniferaActinidia chinensis26.0118.6496.177forward
CNT3085655Vitis viniferaVigna radiata28.0417.3395.1883forward
CNT30542021Vitis viniferaBrassica napus26.6914.7493.6779forward
CNT30233654Vitis viniferaBrassica oleracea28.0417.2692.7783forward
CNT30172276Vitis viniferaTrifolium pratense26.3516.1296.1578forward
CNT30145007Vitis viniferaMedicago truncatula23.3111.6298.5569forward
CNT30442977Vitis viniferaAegilops tauschii23.6514.9395.7170forward
CNT30242945Vitis viniferaAvena sativa26.6911.9292.4179forward
CNT30313662Vitis viniferaCamelina sativa26.3516.9693.5978forward
CNT3061383Vitis viniferaArabidopsis lyrata23.9911.694.3771forward
CNT3083138Vitis viniferaBrassica juncea26.6914.1693.6779forward
CNT30259134Vitis viniferaBrassica rapa26.699.4593.6779forward
CNT30601041Vitis viniferaFraxinus excelsior27.3614.5296.381forward
CNT30468162Vitis viniferaSaccharum spontaneum27.0310.939580forward
CNT30132841Vitis viniferaLolium perenne26.6915.1992.4179forward
CNT30605418Vitis viniferaGossypium raimondii28.3829.6894.0584forward
CNT30217757Vitis viniferaKalanchoe fedtschenkoi26.3519.4597.4478forward
CNT30652772Vitis viniferaRosa chinensis27.3613.6195.0681forward
CNT30213082Vitis viniferaHelianthus annuus29.0519.1594.1986forward
CNT30126894Vitis viniferaCorymbia citriodora27.0322.1697.580forward
CNT30715353Vitis viniferaMalus domestica golden27.76.6796.3482forward
CNT30625768Vitis viniferaDaucus carota2512.8994.5974forward
CNT30722856Vitis viniferaTriticum spelta28.0419.6293.9883forward
CNT30348934Vitis viniferaEragrostis tef23.653.9597.1470reverse complement
CNT30479698Vitis viniferaArabidopsis halleri26.3517.0394.8778forward
CNT30620847Vitis viniferaCajanus cajan28.3823.4695.2484forward
CNT30596688Vitis viniferaOryza meridionalis29.0515.9695.3586forward
CNT30355299Vitis viniferaLactuca sativa29.0512.3794.1986forward
CNT30424191Vitis viniferaPapaver somniferum27.718.0295.1282forward
CNT30704989Vitis viniferaPrunus avium28.0410.9196.3983forward
CNT30642554Vitis viniferaCannabis sativa28.0414.3892.7783forward
CNT3032717Vitis viniferaTheobroma cacao26.699.0494.9479forward
CNT3057178Vitis viniferaAmborella trichopoda22.9711.7995.5968reverse complement
CNT3025185Vitis viniferaPopulus trichocarpa27.0313.3898.7580forward
CNT30324349Vitis viniferaAsparagus officinalis26.6916.5392.4179forward
CNT30120214Vitis viniferaCitrus clementina28.0416.1898.883forward
CNT3038456Vitis viniferaCucumis melo27.03169580forward
CNT30584684Vitis viniferaEchinochloa crusgalli27.0316.7493.7580forward
CNT30499031Vitis viniferaDigitaria exilis27.3615.1492.5981forward
CNT30593864Vitis viniferaEragrostis curvula27.3614.5292.5981forward
CNT30604511Vitis viniferaOryza punctata27.715.7493.982forward
CNT30174981Vitis viniferaVigna angularis28.0416.8796.3983forward
CNT30112246Vitis viniferaFicus carica28.0414.8797.5983forward
CNT30724898Vitis viniferaLupinus angustifolius28.7215.495.2985forward
CNT3048749Vitis viniferaCucumis sativus27.0315.419580forward
CNT30115398Vitis viniferaEutrema salsugineum27.716.7395.1282forward

Expression of CNT30572709

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MNGPHQSIHRDLLDRNLVFNSSFKLVQIIGIPIR

>peptide 2 (36 aa)
NTSTALKTQNLCPLYQQPSRKIRVLQRRKAIITRSP*

>peptide 3 (38 aa)
ILRQPSRPKISALFTSSLAEKLGFYREGRLSSPDHHES*

Sequence

>CNT30572709
AATACTTCGACAGCCCTCAAGACCCAAAATCTCTGCCCTCTTTACCAGCAGCCTAGCAGAAAAATTAGGGTTTTACAGAGAAGGAAGGCTATCATCACCC
GATCACCATGAGAGCTAAGTGGAAGAAGAAGCGTATGAGGAGGTTGAAGAGGAAGCGCCGAAAGATGAGGCAGAGATCCAAGTAGGCGAACCAATGAACG
GTCCTCATCAATCCATCCACCGAGATCTCCTAGACCGGAATCTGGTATTCAATTCATCATTCAAACTAGTACAAATAATTGGCATACCCATCCGTG