Detailed information on CNT30570674


BLAST search results

BLAST vs Swiss-Prot:
sp|P31155|METK1_PETCR, E-value = 5e-81

BLAST vs NONCODE:
NONPOPT000585, E-value = 6e-66

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673492Vitis viniferaSetaria viridis38.9837.7883.97368forward
CNT30521128Vitis viniferaSetaria italica39.5150.9683.65373forward
CNT30641080Vitis viniferaNymphaea colorata32.7334.5382.2309forward
CNT30549537Vitis viniferaIpomoea triloba38.0353.986.07359forward
CNT30618114Vitis viniferaSesamum indicum22.4646.981.6212forward
CNT30729048Vitis viniferaCorchorus capsularis30.443.7585.71287forward
CNT30490001Vitis viniferaOlea europaea27.7552.8288.17262forward
CNT30711739Vitis viniferaGlycine max53.3942.1184.33504forward
CNT3047443Vitis viniferaPrunus dulcis34.8527.5886.63329forward
CNT30638840Vitis viniferaCapsicum annuum35.4939.2382.39335forward
CNT30181754Vitis viniferaSecale cereale30.9346.4283.56292forward
CNT30292894Vitis viniferaTriticum aestivum30.9350.9684.59292forward
CNT30561874Vitis viniferaActinidia chinensis26.0627.8985.77246forward
CNT30508528Vitis viniferaSolanum lycopersicum26.848.7583253forward
CNT30144140Vitis viniferaMedicago truncatula28.8172.9283.46272forward
CNT30441680Vitis viniferaAegilops tauschii9.1141.5590.786forward
CNT30662024Vitis viniferaTriticum dicoccoides39.6273.6284.76374forward
CNT30606743Vitis viniferaGossypium raimondii38.0333.6184.4359forward
CNT30218668Vitis viniferaKalanchoe fedtschenkoi22.5655.0486.85213forward
CNT30620812Vitis viniferaCajanus cajan3425.8586.6321forward
CNT30597163Vitis viniferaOryza meridionalis19.8131.4883.42187forward
CNT30432398Vitis viniferaPapaver somniferum34.8527.182.98329forward
CNT3024331Vitis viniferaPopulus trichocarpa38.3534.7187.02362forward
CNT30496713Vitis viniferaDigitaria exilis25.7416.1481.48243forward
CNT30174554Vitis viniferaVigna angularis43.4357.182.44410forward
CNT30551132Vitis viniferaOryza brachyantha9.1122.2888.3786forward
CNT30725315Vitis viniferaLupinus angustifolius37.1834.8983.76351forward

Expression of CNT30570674

Peptides detected in this lncRNA

>peptide 1 (40 aa)
LVKHLIASIKRKMQNRIKMKKRQLKLADITKQSNKLTASQ*

>peptide 2 (65 aa)
MLFEISCNLVIGDSLVVLGGNEDSVYADWNPGTTIIVVFDSYLGFTIRPQPWAGAILADFSEAGT*

>peptide 3 (57 aa)
MAKGHQLRSLIGGIAEHMALVTSTNLLRPLGEMAMDTLGNIWTLLLNVDKDLAVVSI*

>peptide 4 (86 aa)
MTCSLRSAAISSLVTVSSCWVEMRTVCTRIGTLAPPSLWYSTVTWVLPSGLNHGQVPFLRTSVRRAPSFVARTWLRGISSGVSSVA*

Sequence

>CNT30570674
CTTTAGTTAAACATTTGATAGCATCAATTAAGAGGAAGATGCAAAATCGAATAAAAATGAAAAAAAGACAACTTAAACTCGCAGATATAACGAAGCAAAG
CAACAAGCTAACAGCGTCCCAGTAACTGAGATTACGCTTGCGTCTTCTCCCACTTGAGGGGCTTTACCACCTCCCATGTGAAATCAGGGTCATCTCTGCC
AAAGTGCCCATAAGCAGCAGTCTTCAAGAACCTGCCATTGCCACCCCTCTTGAGGTCAAGGTTGATGGAAATCATCCCGGGCCTGAAATCAAAGTTCTCC
TTCACAATCTTGAGTATCTCCCTGTCGGGGATCTTTCCAGTACCATAGGTGTCCACGAAAACTGACAAGGGTTCAGGCACACCAATAGCATAAGACACCT
GCACGATGCACCTCCTAGCCAGCCCATTGGCCACAATGCTCTTTGCAGCCTGCCTAACAATGTAAGCTCCACTCCTATCAACTTTAGTGGGGTCTTTCCC
AGAGAAGGCTTGATGACATGCTCTTTGAGATCAGCTGCAATCTCGTCATTGGTGACAGTCTCGTCGTGCTGGGTGGAAATGAGGACAGTGTGTACGCGGA
TTGGAACCCTGGCACCACCATCATTGTGGTATTCGACAGTTACTTGGGTTTTACCATCAGGCCTCAACCATGGGCAGGTGCCATTCTTGCGGACTTCAGT
GAGGCGGGCACCTAGCTTTGTTGCAAGGACATGGCTAAGGGGCATCAGCTCCGGAGTCTCATCGGTGGCATAGCCGAACATATGGCCTTGGTCACCAGCA
CCAATCTCCTCAGGCCGCTTGGTGAGATGGCCATGGACACCCTGGGCAATATCTGGACTTTGCTGCTCAATGTTGACAAGGACCTTGCAGTTGTCAGCAT
CTAGACCCACATCGTCAGATACAAATCCAATTTCCCGACACGTG