Detailed information on CNT30570509


BLAST search results

BLAST vs Swiss-Prot:
sp|O49954|GCSP_SOLTU, E-value = 7e-130

BLAST vs NONCODE: nothing found

Expression of CNT30570509

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MLLVALSLRICCSLVCIAIRRAGFPEASTLTPIILPGIILLYSWEVAKKAA*

>peptide 2 (34 aa)
MLLHIAIASAAAVPSSSNDALDMGRPVKSEIKVW*

>peptide 3 (29 aa)
LSSAYVARSLVPPDMLFSRLHCHTQSRLS*

>peptide 4 (76 aa)
MSILYELPDTTNITRFVINILKISSNYFKIKTFSSSLTNINCLWVAIASNNKSFLLSLHNVITHSHCLSCSSSFIK*

>peptide 5 (33 aa)
MRWTWVGQLNQKSRSGNSAMTPNVLGQSQPAKSF

Sequence

>CNT30570509
CCTGAGCAGTGCATATGTTGCTCGTAGCCTTGTCCCTCCGGATATGTTGTTCTCTCGTCTGCATTGCCATACGCAGAGCAGGCTTTCCTGAAGCATCAAC
ACTGACTCCAATAATTCTTCCTGGCATCATCCTCTTGTACTCTTGGGAGGTGGCCAAGAAAGCAGCATGAGGACCACCATACCCCATCGGTACTCCAAAC
CGCTGAGCTGAGCCAACAACAATATCTGCCCCAAACTCACCTGGAGGCTTCAACATTGTCAATGCCAACAGATCACTTGCCATAACAACCTTAACCCCAT
TAGCATGAGCATTCTTTATGAACTCCCCGACACCACAAACATCACCCGATTTGTAATCAATATCCTTAAGATCAGCAGTAACTACTTTAAGATCAAAACC
TTCAGCTCTAGTCTTACAAATATCAATTGTCTGTGGGTGGCAATTGCTAGCAATAATAAAAGTTTTCTTCTTTCCCTTCATAATGTTATTACACATAGCC
ATTGCCTCAGCTGCAGCAGTTCCTTCATCAAGTAACGATGCGTTGGACATGGGTAGGCCAGTTAAATCAGAAATCAAGGTCTGGTAATTCAGCAATGACT
CCAAACGTCCTTGGGCAATCTCAGCCTGCTAAAAGTTTTC