Detailed information on CNT30562761


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9M040|PDC4_ARATH, E-value = 4e-89

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522505Actinidia chinensisSetaria italica20.0557.6687.84222forward
CNT30640997Actinidia chinensisNymphaea colorata12.0134.9183.46133forward
CNT30223464Actinidia chinensisHordeum vulgare8.4946.5386.1794forward
CNT30136353Actinidia chinensisLolium perenne20.0524.4888.74222forward
CNT30202534Actinidia chinensisHelianthus annuus23.454.1881.85259forward
CNT30362074Actinidia chinensisSorghum bicolor17.3434.188.02192forward
CNT30101892Actinidia chinensisOryza rufipogon19.9636.1188.69221forward
CNT30576296Actinidia chinensisOryza barthii19.9646.9289.14221forward

Expression of CNT30562761

Peptides detected in this lncRNA

>peptide 1 (32 aa)
WLKESSNHFIKLVSNQCGTKFFTKSRKSFIKF*

>peptide 2 (37 aa)
MLASSGASKRRRCAGCCPRRCTVACTRQVLRSYCPSL*

>peptide 3 (41 aa)
MAKRELQSFHQTCIKSMWNQIFYQIKEIIHQILNGHILTQI*

>peptide 4 (56 aa)
MAAQSRLGRVERGGCWRALERRNDVVVRDAAHVVARWLAHVKCSDLTVHRYNDEYNP

>peptide 5 (32 aa)
MHLSIFLLKNLSVLKNHQNPKPLSHETDTRYR*

>peptide 6 (85 aa)
MRWSRSVRLKSPGTEKTSVAPIWTSRRARWRPRVDSAELSAVDAGELWSVETTSLCGMLPTSLHGGLHTSSAPILLSIAIMMSTTL

Sequence

>CNT30562761
ATGGCTAAAAGAGAGCTCCAATCATTTCATCAAACTTGTATCAAATCAATGTGGAACCAAATTTTTTACCAAATCAAGGAAATCATTCATCAAATTTTAA
ATGGTCACATTCTTACTCAAATTTGAACAAATTTTAGAAAGTAAAAGAATTGGAGTGGATTTTCTTTCATAAAATTGGTTTAAGAAAAAGGTTTCGAGAT
AAGTTGATAATTTTTTGAAAAGATTTGGTAATAAAAAAAAAAGAGTTAAGGATTGGAGATGACCTAAGATCACCAAAATTCAAATTTAAAATGGTCTCAA
TTTTTACTCAAATATGATGAAATTTCTAGAAAAAGAGAAGGATTGAGGTGAGTTTTCAATCATAAACAATGGTTAAAAGAGATTTTGGCACAATTTTTTA
AATAGATTTTGGTTTTAGAAAAATAGTGAAAAATGAATGCATTTGTCAATTTTTTTACTCAAAAATCTAAGTGTTCTTAAGAATCATCAAAATCCAAAGC
CACTATCGCATGAAACAGATACTAGATATCGCTAAATTATGATGATCAAACACAAAATCAAGTGGTTTTTGCTCTGACCTGAAAGCAAGTAACAGTTTGA
AAGCAGCGAAGCTCTTGACTAAAATCAGGCAGTCCGATGGTGTGGTGAAGGATTCTGTTAGTGCCGTAATCGTTGGAATTCGGGCCGCCAACGATGCAGA
TGACGGGGAGGTTCTCGCTGTAGGCGCCTGCGACGGCGTTGAGGACGCTGAGGCCGCCGACGGTGAAGGTGACGACGCAGGCGCCGACGCCACGGGAGCG
GGCGAAACCGTCGGCGGCGTAGCCGGCGTTGAGCTCGTTGCAACAGCCGATGAGGTGGTCAAGGAGCGTCAGGTTGAAGTCGCCGGGTACGGAGAAGACG
TCGGTGGCGCCGATCTGGACCAGCCGGCGCGCGAGATGGCGGCCCAGAGTCGACTCGGCCGAGTTGAGCGCGGTGGATGCTGGCGAGCTCTGGAGCGTCG
AAACGACGTCGTTGTGCGGGATGCTGCCCACGTCGTTGCACGGTGGCTTGCACACGTCAAGTGCTCCGATCTTACTGTCCATCGCTATAATGATGAGTAC
AACCCTT