Detailed information on CNT30562219


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 3e-148

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30562219

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MPSLSWIFALTLSMVSELSTSRVMVLPYFDTL*

>peptide 2 (40 aa)
MVSELSTSRVMVLPVRVLTKICMPPRRRRTRWRVDSFWML*

>peptide 3 (40 aa)
MVSELSTSRVIVFPVRVLTKICMPPRRRRTRCRVDSFCML*

Sequence

>CNT30562219
GGGCAAACATCACTTCCACTGCAATGATAAAACCACAAGAAACTGAACAACACCATCCACTGAACTAAAAGAAAAGCACAAACGATTTATTGATAACCCA
TGTTAGGGTAACACACAATACCAACTAAAATATAAAGAGAACCACATCACTCCAAATCATAGGGAAATCAAATAGAAGCCATGGACAGTTTTTGGAAACC
ACCACAGACAAGGTGAAGGGTTGACTCCTTCTGGATGTTATAATCTGCAAGGGTTCGGCCATCCTCGAGCTGCTTCCCAGCAAAGATCAGCCTCTGCTGA
TCTGGTGGGATCCCCTCCTTGTCCTGAATTTTTGCCTTGACATTGTCAATGGTATCAGAGCTTTCAACCTCAAGGGTAATAGTTTTTCCGGTGAGGGTCT
TGACAAAAATCTGCATGCCACCGCGGAGGCGGAGGACAAGGTGCAGGGTCGATTCCTTCTGTATGTTGTAGTCTGCTAGGGTGCGGCCATCCTCAAGCTG
TTTGCCGGCGAAGATCAGCCTCTGCTGGTCCGGTGGGATCCCTTCCTTGTCTTGAATCTTGGCCTTGACATTGTCAATGGTGTCGGAGCTTTCCACCTCG
AGGGTGATGGTCTTGCCTGTGAGGGTCTTAACGAAGATCTGCATGCCACCACGGAGGCGGAGGACGAGGTGGAGGGTAGACTCCTTCTGGATGTTGTAGT
CCGCTAGGGTGCGGCCGTCCTCGAGCTGCTTTCCAGCAAAGATCAGCCTTTGCTGGTCTGGTGGGATGCCTTCTTTGTCCTGGATCTTTGCCTTGACATT
ATCGATGGTGTCAGAGCTTTCCACCTCGAGGGTGATGGTCTTGCCGTATTTTGATACCTTGTAGAGAGAGAGAGAGAGAGATTGATTAGAGATAATATAG
ATCTGATCTCTTCT