Detailed information on CNT30561161


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT30561161

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MPTRDQRMLLLGLRWHLMRNQSFWVPGGVWSQG*

>peptide 2 (33 aa)
RPLIWKTVVLVFDLSDCSARLMRCQRRKGMLPG*

>peptide 3 (44 aa)
MHLLDKRSTRALPVALMIHDNSTDRTAFVPATHHSNFCPINFRW*

>peptide 4 (52 aa)
MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS*

>peptide 5 (51 aa)
MITRRIARPSCRRRIIQISALSTFDGRIVAYYGVNGRANYPILTRGGSDNK*

Sequence

>CNT30561161
CGACCCTTAATTTGGAAGACTGTTGTGCTCGTCTTTGACCTATCCGATTGCTCGGCTAGGCTCATGCGGTGCCAACGTCGCAAAGGAATGCTACCTGGTT
GATCCTGCCAGTAGTCATATGCTTGTCTCAAAGATTAAGCCATGCATGTGTAAGTATGAACTAATTCAGACTGTGAAACTGCGAATGGCTCATTAAATCA
GTTATAGTTTGTTTGATGGTATTTGCTACTCGGATAACCGTAGTAATTCTAGAGCTAATACGTGCAACAAACCCCGACTTCTGGAAGGGATGCATTTATT
AGATAAAAGGTCGACGCGGGCTTTGCCCGTTGCTCTGATGATTCATGATAACTCGACGGATCGCACGGCCTTCGTGCCGGCGACGCATCATTCAAATTTC
TGCCCTATCAACTTTCGATGGTAGGATAGTGGCCTACTATGGTGTTAACGGGCGCGCAAATTACCCAATCCTGACACGGGGAGGTAGTGACAATAAATAA
CAATACCGGGCTCATTGAGTCTGGTAATTGGAATGAGTACAATCTAAATCCCTTAACGAGGATCCATTGGAGGGCAAGTCTGGTGCCAGCAGCCGCGGTA
ATTCCAGCTCCAATAGCGTATATTTAAGTTGTTGCAGTTAAAAAGCTCGTAGTTGGATTTTGGGTTGGGCCGACCGGTCCGCCTTCAGGTGTGCACCGGT
CGTCTCGTCCCTTCTGCCGGCGATGCGCTCCTAGCCTTAACTGGCCGGGTCGTGCCTCCGGCGCTGTTACTTTGAAGAAATTAGAGTGCTCAAAGCAAGC
CTACGCTCTGGATACATTAGCATGGGATAACATCATAGGATTTCGATCCTATTCTGTTGGCCTTCGGGATCGGAGTAATGATTAACAGGGACAGTCGGGG
GCATTCGTATTTCATAGTCAGAGGTGAAATTCTTGGATTTATGAAAGACGAACAACTGCGAAAGCATTTGCCAAGGATGTTTTCATTAATCAAGAACGAA
AGTTGGGGGCTCGAAGACGATCAGATACCGTCCTAGTCTCAACCATAAACGATGCCGACCAGGGATCAGCGGATGTTACTTTTAGGACTCCGCTGGCACC
TTATGAGAAATCAAAGTTTTTGGGTTCCGGGGGGAGTATGGTCGCAAGGCTGAAACTTAAAGGAATTGACGGAAGGGCACCACCAGGAGTGGAGCCTGCG
GCTTAATTTGACTCAACACG