Detailed information on CNT30558445


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676339Panicum halliiSetaria viridis57.3667.6695.58339forward
CNT30524121Panicum halliiSetaria italica10095.3293.91591forward
CNT3017870Panicum halliiZea mays40.7859.5189.63241forward
CNT30339804Panicum halliiEragrostis tef66.1637.6384.65391forward
CNT30365991Panicum halliiSorghum bicolor50.9399.0189.04301forward
CNT30603977Panicum halliiOryza punctata52.9677.8679.87313forward

Expression of CNT30558445

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MLQDMTCLSSFKILSESDGIFLPLAKATGSID

>peptide 2 (30 aa)
MMFSDTRHRNVKELLMLPWHATRHDMLVFI*

>peptide 3 (72 aa)
MKEEAGRNWEMKEEASMNCGLEEEVSKQQLGEEVSKRQKLDGEASKQQNLEEEVRDEVGSSNHPSSSLVTSG*

>peptide 4 (52 aa)
VPLPSNFPFFHCDWDCEKVVGDEGRGGQELGDEGRGEHELWVGGRGEQAAAG*

>peptide 5 (43 aa)
MYGLLGQGRGFSFLEQKDLQIPFFHVSNWFHLLKVRRCANDVL*

>peptide 6 (42 aa)
MANVWPFGTGERLLVLGAKRSSDTVLPREQLVSLVEGSSLCK*

Sequence

>CNT30558445
GTACCACTCCCTAGCAATTTCCCTTTTTTCCATTGTGATTGGGACTGTGAGAAAGTAGTGGGAGATGAAGGAAGAGGCGGGCAGGAACTGGGAGATGAAG
GAAGAGGCGAGCATGAACTGTGGGTTGGAGGAAGAGGTGAGCAAGCAGCAGCTGGGTGAAGAGGTGAGCAAGCGCCAGAAGCTGGATGGAGAGGCGAGCA
AGCAGCAGAACCTGGAGGAAGAGGTAAGGGATGAGGTGGGCTCCTCAAACCATCCATCATCCTCACTGGTGACCTCGGGCTAAACCCGAAGTCTCTAGAA
TTTCCATTGCTCATGGCGAATGTATGGCCTTTTGGGACAGGGGAGAGGCTTCTCGTTCTTGGAGCAAAAAGATCTTCAGATACCGTTCTTCCACGTGAGC
AACTGGTTTCACTTGTTGAAGGTTCGTCGTTGTGCAAATGATGTTCTCTGACACTAGACACAGGAATGTCAAAGAACTTCTGATGCTCCCGTGGCATGCT
ACAAGACATGACATGCTTGTCTTCATTTAAGATTCTATCTGAATCAGATGGCATATTTCTTCCCCTCGCAAAAGCAACAGGATCCATTGAC