Detailed information on CNT30553249


BLAST search results

BLAST vs Swiss-Prot:
sp|P49637|R27A3_ARATH, E-value = 2e-48

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641194Oryza glaberrimaNymphaea colorata32.6619.6387.15179forward
CNT30531335Oryza glaberrimaEucalyptus grandis17.5232.2191.6796forward
CNT30371729Oryza glaberrimaArabidopsis thaliana35.0435.1682.29192forward
CNT30161234Oryza glaberrimaPistacia vera25.5560.0987.86140forward
CNT30287025Oryza glaberrimaTriticum aestivum37.2337.0993.14204forward
CNT30451383Oryza glaberrimaSaccharum spontaneum36.3135.7990.45199forward
CNT30227365Oryza glaberrimaAnanas comosus39.631.9689.4217forward
CNT30650917Oryza glaberrimaRosa chinensis39.2333.6586.98215forward
CNT30362394Oryza glaberrimaSorghum bicolor42.3435.9190.52232forward
CNT30110917Oryza glaberrimaOryza longistaminata42.1546.1197.84231reverse complement
CNT30496106Oryza glaberrimaDigitaria exilis42.3433.0590.09232forward

Expression of CNT30553249

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MRPCPADTWPRFFRFFLKRVVMAAAELRAARRRRRVAA

Sequence

>CNT30553249
CTGCAAGATCATGTAGCAATCAGATTAGCACGCGGCAGACGCAAATATTGATATAGACCGGCATAATCATGTAATTCAAAACTCCTGAATTGCCACCACA
GATTCAAGTAGCCATACCATACAGTAGTAACATCCATAACAGAAAACGCACAAGAGCTAAATCAAAGTCTTTTGAAGGATAAAGAAACTAGCGCCTTAGA
TATCAAGAACCCTCCTCCCTCCAACTCAACTCCCAAGTATGTAGTACCTAGGCGGTGAGGAGGACGGCGCTCGACGTTGACGGCGGGGCAGTGGAACCTG
TTGCTGAGCTTGTGGAAGTAGCGCATGCCGACCTTGCCGAAGTAGCCCGGGTGGTACTTGTCGAACAGGATCCGGTGGTGGTGCATCCCTCCGGCGTTAC
CGCGGCCTCCGGGGTGCTTGCGGTGCTTCCCGATGCGCCCGTGCCCGGCCGACACGTGGCCGCGCTTCTTCCGGTTCTTCTTGAAGCGCGTTGTCATGGC
AGCGGCGGAGCTGCGAGCGGCGCGGCGGCGGAGGCGGGTGGCGGCGGG