Detailed information on CNT30552942


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7PC73|CSLA5_ORYSJ, E-value = 1e-70

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692204Oryza glaberrimaOryza sativa59.7651.5399.34303forward
CNT30575849Oryza glaberrimaOryza barthii52.2794.64100265forward

Expression of CNT30552942

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MANQIHPKGDNQECCRNVGNAPDWQEELWDHDRHRDDNIVENKGNSRGNNSPHQEEAIQHVDLL

>peptide 2 (42 aa)
MRNTDNPISGRFTLQQMTMSAMESHYSRRRHCSPLSSSRSIG*

>peptide 3 (32 aa)
MDMTLSNKIHSGTVCRFLERKDSYGKSNSSKR*

Sequence

>CNT30552942
CTTGGAGATAGAGATTTATGTAGAAGCTGTTCTTTCCATGGAAGACAAGGTTGTAGGATGCACAAAAGATGAGGAACACCGATAATCCGATCTCAGGCAG
ATTCACTCTGCAGCAAATGACAATGTCAGCAATGGAGTCTCATTATTCTCGTCGAAGGCATTGTTCCCCACTTTCTTCGTCACGATCCATTGGTTGAATT
CTTGCAGTTGCAGCAGACCAGCTACAGCAGCTCTCAACCGATGCATGGACATGACGCTCTCGAATAAAATCCACAGTGGCACTGTGTGCAGATTTCTGGA
GCGAAAAGACAGTTATGGCAAATCAAATTCATCCAAAAGGTGACAATCAGGAGTGCTGTAGGAATGTAGGCAACGCCCCAGATTGGCAGGAAGAGCTCTG
GGATCATGACCGACACAGGGATGATAACATTGTAGAGAATAAAGGCAACAGCAGGGGCAACAACTCTCCTCACCAGGAAGAAGCTATACAGCATGTAGAT
CTTCTTC