Detailed information on CNT30531335


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30641194Eucalyptus grandisNymphaea colorata44.314.4786.36132forward
CNT30371729Eucalyptus grandisArabidopsis thaliana39.2621.4383.76117forward
CNT30161234Eucalyptus grandisPistacia vera21.1427.0485.7163forward
CNT30287025Eucalyptus grandisTriticum aestivum36.2419.6487.96108forward
CNT30553249Eucalyptus grandisOryza glaberrima32.2117.5291.6796forward
CNT30451383Eucalyptus grandisSaccharum spontaneum27.5214.7597.5682forward
CNT30231250Eucalyptus grandisAnanas comosus46.9830.0485.71140forward
CNT30650917Eucalyptus grandisRosa chinensis36.2416.991.67108forward
CNT30362394Eucalyptus grandisSorghum bicolor27.5212.6996.3482forward
CNT30496106Eucalyptus grandisDigitaria exilis27.1811.5493.8381forward

Expression of CNT30531335

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MESASIVYNCKRGNPKKLPRMEPLSGEHDGLVLGVLGDQRPQLLDVDDGAVELVAELVEVPHADLAEVPRMVLVE

Sequence

>CNT30531335
CAAAAATTAAGCTCTCGGTCTGCATAAAGTAAACAGATCCAGATCCAATTACAACCAAGCGTCAAAATCATAATGGAAAGCGCATCAATTGTATATAATT
GCAAACGGGGAAACCCTAAAAAGCTACCGCGAATGGAGCCCCTAAGCGGTGAGCACGACGGCCTTGTCCTTGGCGTCCTGGGGGACCAGCGACCACAGCT
TCTCGACGTTGACGATGGGGCAGTAGAACTTGTTGCGGAGCTTGTGGAAGTACCGCATGCCGACCTTGCCGAAGTACCCCGGATGGTACTTGTCGAAG