Detailed information on CNT30509914


BLAST search results

BLAST vs Swiss-Prot:
sp|O82392|THIC_ARATH, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678480Solanum lycopersicumSetaria viridis27.6131.3184.95299forward
CNT30522049Solanum lycopersicumSetaria italica27.6165.8684.95299forward
CNT30549847Solanum lycopersicumIpomoea triloba25.2166.9184.62273forward
CNT30727441Solanum lycopersicumCorchorus capsularis32.4158.1182.62351forward
CNT3094458Solanum lycopersicumSolanum tuberosum43.0390.4997.64466forward
CNT30144604Solanum lycopersicumMedicago truncatula23.4562.4185.43254forward
CNT30340692Solanum lycopersicumEragrostis tef28.7286.1581.03311forward
CNT30483750Solanum lycopersicumChara braunii13.7641.7479.87149forward
CNT3048758Solanum lycopersicumCucumis sativus46.0889.7583.97499forward

Expression of CNT30509914

Peptides detected in this lncRNA

>peptide 1 (89 aa)
MVQECKMVLHYTTLAVSACSRESYALVHVQVSVHHQLITIYRTDYRCQVCHPNVHKRNSPCDKLSTTLHELSLHEKQFRSSVLLSVGCT*

>peptide 2 (32 aa)
LISSVIFMEQNLGPHIEQKCATLAPSAGKVSS*

>peptide 3 (38 aa)
MLALTFTKNFLPTIIGSNSGCFLFEGMIARPRATSDLTN

Sequence

>CNT30509914
TTCTTATATCTTCGGTTATTTTCATGGAGCAAAACTTAGGCCCGCACATAGAGCAGAAATGTGCCACTTTAGCCCCATCGGCTGGTAAAGTTTCGTCGTG
AAAGGACATTGCAGTAACGGGGTCCAATGATAAAGCGAATTGGTCCATCCATCTGAACTCAAATCTTGCCTTGCTAAGTGCATCATCCCAGGCTTGAGAT
AGCGGGTGACCTTTTGCAAGATCAGCTGCATGAGCAGCTATCTTATATGATATTACACCTGTCTTCACGTCATCGCGATTAGGCAGACCAAGATGCTCTT
TTGGAGTGACGTAACACAGAAGTGCAGTCCCGAGTGCTCCTATATTGGCTGCACCGATAGCTGAGGTGATATGATCATATCCGGGAGCTATATCAGTTGT
CAATGGTCCAAGAGTGTAAAATGGTGCTTCATTACACCACTCTAGCTGTTTCTGCATGTTCTCGGGAATCTTATGCATTGGTACATGTCCAGGTCTCAGT
CCATCACCAATTGATAACGATATATCGTACTGATTACAGATGTCAAGTATGTCATCCCAATGTTCATAAGCGAAATTCTCCTTGTGATAAGCTAAGCACC
ACTTTGCATGAATTGAGCCTCCACGAGAAACAATTCCGGTCATCCGTTTTGCTGTCAGTGGGATGTACCTGAGAAGGACTCCGGCATGGATTGTGAAGTA
ATCAACTCCTTGCTCAGCTTGTTCAATTAAGGTCTCCCTAAACACTTCCCAACTAAGATTCTCAGCAATCCCGTTTACTTTTTCTAGTGCTTGGTAAATT
GGCACAGTGCCTACTGGTACAGCAGAATTACGCAAGATCCACTCACGAGTCTCGTGGATGTGACGACCAGTAGAGAGATCCATAATCGTATCTGCACCCC
ACATTGTTGCCCATTGAAGCTTGTGAACTTCTTCTTCAATCGAGCTTACAACAGCAGAGTTCCCGATGTTGGCATTGACTTTCACTAAGAACTTTCTTCC
TACTATCATTGGCTCCAACTCAGGGTGCTTCTTGTTTGAAGGGATGATTGCACGGCCCCGAGCAACTTCTGACCTCACAAATT