Detailed information on CNT30488039


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Expression of CNT30488039

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MIRVMDEREFSLHLLAIPCRLLRFIDPFGLLRTFAGQIWRLFAGQCQILCDFISVKLAEEAAKPVILGPPLHDKCK*

>peptide 2 (29 aa)
HVKNFSPTNNGEHSETLILNMDINLRFRF*

>peptide 3 (34 aa)
MEIICRPMPDFVRFHIGEACRRGSEACDFGSPFT*

Sequence

>CNT30488039
CACGTGAAAAACTTTTCTCCTACAAATAACGGGGAGCACTCCGAAACCTTAATTCTTAACATGGATATAAACCTAAGATTCAGGTTCTGATTTGAAAGAT
AAAGAGAAGAAAGGCATATTAATACAAATCAAGAAACCAAGATGATCCGAGTAATGGATGAAAGAGAATTCAGTCTTCATTTACTGGCAATTCCATGCAG
ATTGTTGAGGTTTATTGATCCTTTTGGATTGCTCAGAACATTCGCAGGCCAAATATGGAGATTATTTGCAGGCCAATGCCAGATTTTGTGCGATTTCATA
TCGGTGAAGCTTGCAGAAGAGGCAGCGAAGCCTGTGATTTTGGGTCCCCCTTTACATGATAAGTGTAAATGATGCCATGGAAAAGAACTCATTCATGTTC
GACTTTTACTTTTACCAC