Detailed information on CNT30468056


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30468056

Peptides detected in this lncRNA

>peptide 1 (74 aa)
MAAKFPILLGVVLTTLLLVSHDVVHAAEQAGPSEPQLPEGYGSGYMQPGHNGAYTRGGASGQYGNGGGGGYNHP*

>peptide 2 (81 aa)
MCIYLAMKYDIVHQLENAWIKAGLFMKYDIVHQLENAWIKAGLFAHRTEASKIHNFFRKRVSRFIHPPILKMHQTTVVTKR*

>peptide 3 (57 aa)
MQNKRGRRSHNFQRGMVQAICNLGIMVPTPEATKLASSILTEVQKWLPSSQFFLVSY*

>peptide 4 (67 aa)
MQLNKRGRRSHNFQRGMVQAICNLGIMVPTPEAVQAVNMGTAVAVVIIILDVVMWINIARWWYAIEK*

>peptide 5 (43 aa)
KFPILLGVVLTTLLLVSHDVVHAAGTVVFKLIYRTIVKKNYYY*

>peptide 6 (47 aa)
MLVTPPTFFCTHAEQAGPSEPQLPEGYGSGYMQPGHNGAYTRGDKAC*

>peptide 7 (33 aa)
QVPNSSWCRIDHSPARLPRCSACSWYGGFQTDI*

Sequence

>CNT30468056
CAAGTTCCCAATTCTTCTTGGTGTCGTATTGACCACTCTCCTGCTCGTCTCCCACGATGTAGTGCATGCAGCTGGTACGGTGGTTTTCAAACTGATATAT
AGAACTATTGTCAAGAAGAATTACTATTACTAGTTGCTAGTTGTATATATGCAGGAGACGCTATGCTAGTAACACCACCTACATTCTTTTGCACACATGC
AGAACAAGCGGGGCCGTCGGAGCCACAACTTCCAGAGGGGTATGGTTCAGGCTATATGCAACCTGGGCATAATGGTGCCTACACCAGAGGCGACAAAGCT
TGCTAGCTCTATACTCACAGAAGTTCAGAAATGGCTGCCAAGTTCCCAATTCTTCTTGGTGTCGTATTGACCACTCTCCTGCTCGTCTCCCACGATGTAG
TGCATGCAGCTGAACAAGCGGGGCCGTCGGAGCCACAACTTCCAGAGGGGTATGGTTCAGGCTATATGCAACCTGGGCATAATGGTGCCTACACCAGAGG
CGGTGCAAGCGGTCAATATGGGAACGGCGGTGGCGGTGGTTATAATCATCCTTGATGTGGTCATGTGGATCAATATTGCTAGGTGGTGGTATGCAATAGA
AAAATAACACGAGTACTATCTATCTATGTTATCTAGCTATGAAATAAGACATCGTTCATCAGCTTGAAACCGCTATCTATCTATGTGTATCTATCTAGCT
ATGAAATATGACATCGTTCATCAGCTTGAAAACGCTTGGATAAAAGCAGGATTGTTTATGAAATATGACATCGTTCATCAGCTTGAAAACGCTTGGATAA
AAGCAGGATTGTTTGCTCACAGAACTGAAGCTAGTAAGATCCATAATTTTTTTAGAAAAAGGGTTTCCCGCTTCATACATCCTCCGATATTGAAGATGCA
TCAGACCACAGTTGTTACAAAGAGATAGCACACGTTCCAACAATGAATCATGTAGCCAAGACATCACAAACTCTCATG