Detailed information on CNT30465888


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONTAET000308, E-value = 1e-116

Expression of CNT30465888

Peptides detected in this lncRNA

>peptide 1 (40 aa)
DKRLTRALLADPMIHDNLTDRTALVPATHHSNFCPINFRW*

Sequence

>CNT30465888
GATAAAAGGCTGACGCGGGCTCTGCTCGCTGATCCGATGATTCATGATAACTTGACGGATCGCACGGCCCTCGTGCCGGCGACGCATCATTCAAATTTCT
GCCCTATCAACTTTCGATGGTAGGATAGGGGCCTACCATGGTGGTGACGGGTGACGGAGAATTAGGGTTCGATTCCGAAGAGGGAGCCTGAGAAACGGCT
ACCACATCCAAGGAAGGCAGCAGGCGCGCAAATTACCCAATCCTGACATG