Detailed information on CNT30465116


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676566Saccharum spontaneumSetaria viridis17.4720.5987.7698forward
CNT30288286Saccharum spontaneumTriticum aestivum38.3237.7994.88215forward
CNT30221551Saccharum spontaneumHordeum vulgare27.6317.2690.97155forward
CNT30385999Saccharum spontaneumTriticum turgidum42.0744.4494.92236forward
CNT30658162Saccharum spontaneumTriticum dicoccoides42.0742.3794.92236forward
CNT304088Saccharum spontaneumZea mays44.9236.4798.02252forward
CNT30680437Saccharum spontaneumTriticum urartu38.1541.0795.79214forward
CNT30346859Saccharum spontaneumEragrostis tef29.2337.192.07164forward
CNT30365811Saccharum spontaneumSorghum bicolor45.4539.7297.25255forward
CNT30498309Saccharum spontaneumDigitaria exilis45.143.1791.7253forward
CNT30594547Saccharum spontaneumEragrostis curvula27.6331.4494.19155forward
CNT30558465Saccharum spontaneumPanicum hallii18.185195.1102forward

Expression of CNT30465116

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MYMRTCGQYSIYITSPHYTTFPFPFAGSRL*

>peptide 2 (43 aa)
MNNQIREKKRNKKKELFGVWGLDFALLQIITIIIHQGRAWGKF*

>peptide 3 (69 aa)
MAQMSARSTTETFGVGTRSAIPLSLPLRLGSTSETALAAPVEVGTMLSAAARARRRSRWLASSSLWSPV*

Sequence

>CNT30465116
GCATCTCTGAATAAAGAGGTGCGATGTACATGAGAACCTGCGGCCAATATAGTATATATATTACAAGTCCACATTATACAACGTTTCCATTTCCTTTTGC
CGGAAGTCGATTATAATCCGTCCCTCGACAATGAATAATCAGATAAGGGAGAAAAAAAGAAACAAAAAAAAGGAACTGTTTGGAGTTTGGGGCCTCGATT
TCGCATTATTACAAATTATCACCATCATCATTCATCAGGGAAGAGCCTGGGGAAAATTTTGAAGTCGAGGGTGAGCTACAAATTTTGGAGTACCATGCAA
CGCCTCACTTCCACTTGATGGCGCAGATGTCAGCGAGGTCGACGACGGAGACGTTCGGGGTGGGCACCCGGAGCGCGATCCCGTTGAGCTTACCCTTGAG
GTTGGGGAGCACCAGCGAGACGGCCTTGGCGGCGCCGGTGGAGGTGGGCACGATGTTGAGCGCGGCGGCGCGGGCGCGGCGCAGGTCGCGGTGGCTCGCG
TCCAGCAGCCTCTGGTCGCCGGTGTAGGAGTGGGTGGTGGTCATGGTGCCCTTGATGATGC