Detailed information on CNT30461846


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6ESR4|DHN1_ORYSJ, E-value = 8e-17

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30441712Saccharum spontaneumAegilops tauschii15.0837.1687.6581forward

Expression of CNT30461846

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MDQGPARTRCDLRSWSCARRRRPCGRLHLSSYGSRVSCP*

>peptide 2 (83 aa)
MVAGYLVHDLAQQALLLLAIRAAHVLSVRRRRWRRGRVVRLVLFLLVVSVRLHHGRGRRRRGRYGRVMVGLVVLVVARQLLLDL

>peptide 3 (30 aa)
MILPSKPFFSLPSGLLTSSVCGAGAGAGAA*

>peptide 4 (38 aa)
QVHNIQTLTWNQTKARTKAYTSSNTHCQCRLGLKAHGP*

Sequence

>CNT30461846
CCCAAGTACACAACATCCAAACCCTGACTTGGAACCAAACTAAAGCCCGTACCAAAGCCTACACAAGCAGCAACACTCACTGCCAGTGCCGGTTGGGGCT
TAAAGCACACGGACCTTGACCACGCGATCCACCTTGAAACAAACTTCTTAAAAAGCAAACCAGAACCAAAACACACGCCAACGCTTCTGATGGATCAAGG
CCCGGCCAGGACACGTTGCGACCTTAGGAGCTGGTCTTGTGCTCGCCGGCGGCGTCCTTGTGGTCGTCTTCACCTGAGCTCTTATGGTAGCCGGGTATCT
TGTCCATGATCTTGCCCAGCAAGCCCTTCTTCTCCTTGCCATCCGGGCTGCTCACGTCCTCAGTGTGCGGCGCCGGCGCTGGCGCCGGGGCCGCGTAGTG
CGGCTTGTGCTCTTCCTCCTGGTGGTGAGCGTGCGTCTCCACCACGGGCGCGGGCGCCGCCGCCGGGGCCGGTACGGCCGTGTGATGGTCGGCCTCGTGG
TCCTTGTGGTGGCCCGGCAGCTTCTCCTTGATCTTCT