Detailed information on CNT30455978


BLAST search results

BLAST vs Swiss-Prot:
sp|P51614|CHIT3_VITVI, E-value = 4e-108

BLAST vs NONCODE: nothing found

Expression of CNT30455978

Peptides detected in this lncRNA

>peptide 1 (29 aa)
HVLWSFCTFDQRVLQVKFYSLGIYNTNLS*

>peptide 2 (41 aa)
MCCGHFVLLTRGYCKSSFIHWVYITQTYRRIVWCRVRPCIY*

>peptide 3 (38 aa)
MMPPYLPTPWMAGITVPVSVPGSMYPLPAAWVDAGTPR*

>peptide 4 (53 aa)
MAATRRRARTGGHLRLAAMLLTGLDDETRKLLQLLVQRTSYLLFGLVPWLVVK*

>peptide 5 (45 aa)
MPCDWQVWMSLLWPVQPPEPGSQCPARFRTGVCPLPKVVRNARMT*

Sequence

>CNT30455978
GCATGTGTTGTGGTCATTTTGTACTTTTGACCAGAGGGTATTGCAAGTCAAGTTTTATTCATTGGGTATATATAACACAAACTTATCGTAGAATTGTGTG
GTGTCGTGTTCGTCCGTGCATATATTAGCTACTCGCTACTGTAGTGTGTGTAGCAGATGCATCTTTGTCCCCTGATGATCCGCTCTTATTGTATCTAGTC
CGATAACTTGACGAATGAATAGCCACTGTATCTGTACGGCTACCTCTGCTGTAGCCTGAAGCTTCGTATGCTCAGACGCTGCCCTTCACCTGGGCGCTGT
AGTTGTTCTGCACGTCGTAGAAGCGGTTCCACACCATGATGCCGCCATACTTGCCAACGCCCTGGATGGCGGGGATCACCGTGCCCGTCAGCGTGCCGGG
ATCGATGTACCCGCTGCCCGCGGCCTGGGTCGACGCCGGCACGCCGAGGTAGAAGCTCCCCGCCGTGACGCTGCTGGTCCACGTGCTCCAGGCGTTCACC
AGGTTGGTGTCGTCCCCGTTGGCGTACGCGCACCCGGGGTTGTTGTAGAACTGGATCCACACGTTGTCGAACTGCCCCGTCTGCAGCGCGGGCCCCAGCG
ACGCGTCCGGGTAGGGGCACTGCGGCGACGCCGACAGCAGCACGCTCCCCTTGCCCTTGAGCGCGTTCGCCAGGTCGTCGTAGTGCGCCGACTGCCCGTT
CTCGATGTCGAAGTCGACGCCGTCGAGCACGGCGGCGCCGAGTGGGCGGGTCGAGCCGTCGCTGCCGCCCAGGTAGCTGTTCCACAGGTAGTCGGCCACG
CTGTTGGCGTCGTCGGTGGAGGAGAGGAGCACCTTGATGCCCTGCGACTGGCAGGTCTGGATGTCGCTGCTCTGGCCGGTGCAGCCGCCGGAGCCCGGGT
CACAGTGCCCGGCGAGGTTCAGGACCGGGGTCTGTCCGTTGCCGAAGGTTGTGAGGAACGCGAGGATGACGTAGGCGTAGAGCCCGGAGTTGCAGGTGTC
CGCCAGGGTGCCTTCGTTGCCGTTCTGGCCCCAGTACACCGCGATATTGCCAGCACTGGTGCTGCCAACCATGGCAGCAACGAGGAGAAGGGCCAGAACA
GGAGGCCACTTGAGATTAGCCGCCATGTTGCTTACTGGTCTTGATGATGAGACGAGGAAGCTGCTTCAGTTGCTGGTTCAGAGGACCAGCTACTTGCTTT
TTGGCTTGGTGCCTTGGTTGGTGGTGAAGTAGTGG