Detailed information on CNT30370929


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0J8M2|FER1_ORYSJ, E-value = 1e-55

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695489Oryza glumipatulaOryza sativa96.09100100737forward
CNT30675769Oryza glumipatulaSetaria viridis27.934.4191.12214forward
CNT30523259Oryza glumipatulaSetaria italica16.0423.2592.68123forward
CNT30307945Oryza glumipatulaTriticum aestivum27.7733.690.61213forward
CNT30398830Oryza glumipatulaTriticum turgidum27.7729.590.14213forward
CNT30442884Oryza glumipatulaAegilops tauschii14.8623.2293.86114forward
CNT30248543Oryza glumipatulaAvena sativa14.3428.890110forward
CNT30670012Oryza glumipatulaTriticum dicoccoides27.6431.2290.09212forward
CNT30469592Oryza glumipatulaSaccharum spontaneum15.5125.9388.24119forward
CNT3011815Oryza glumipatulaZea mays28.6826.2888.18220forward
CNT30683972Oryza glumipatulaTriticum urartu27.7730.9190.14213forward
CNT30596741Oryza glumipatulaOryza meridionalis100.5295.6692.35771forward
CNT30103152Oryza glumipatulaOryza rufipogon86.3179.38100662forward
CNT30584428Oryza glumipatulaEchinochloa crusgalli27.7720.4692.49213forward
CNT30117338Oryza glumipatulaOryza nivara97.9196.5399.73751forward

Expression of CNT30370929

Peptides detected in this lncRNA

>peptide 1 (52 aa)
KSRTRIYSLLINCSFKYMEYVFDSSIYDTVMHAYMTPKCDMDMIKQVQQNVH*

>peptide 2 (72 aa)
MYTSSGTCSSTSPSGVISFTLYVACIRSLSPSLLLAGSTDTRAGAGAVATRRDIGNRTWLLSAVAAMAAIAN*

Sequence

>CNT30370929
ACAAGAGTAGAACTAGGATATATAGCTTATTAATTAACTGTTCTTTCAAATACATGGAGTACGTATTTGACAGTAGTATATATGACACAGTAATGCATGC
ATATATGACACCAAAATGTGATATGGATATGATTAAGCAGGTGCAGCAAAACGTACATTAATTAAACAACAACAATTAACCCTCGGGCACGCCTGTGTTT
TGTTATCTCGCTCAACATATACGTACGTAATACTTTGCTTGCATAGCATAGGGACGACGACATTATATTCTTAATTGATAAACTCAAGAACGCATGGAGA
TGGATCGAGAGATTTATAAATATGGAGCTTGCTTGATTGATTAGATGAGGTCGTCCTCCTTGTGGGTCTCGATGACGACGTCGGACTTGGGGTAGGCGTG
GCAGGTGAGGACCCAGCCGGCGGCAACCTGGTCGTCGTCGAGGAAGCTCTGGTCGGACTGGTCGATCCCTTCCTCCTCCGCCTGGTCCAGGATGTACACG
TCGTCCGGCACCTGCAGCTCCACCTCGCCGTCCGGTGTGATCAGCTTCACGTTGTACGTCGCCTGCATCCGCAGCCTGTCTCCCAGCTTGTTGCTCGCCG
GCAGCACCGACACGCGCGCCGGCGCCGGCGCCGTCGCCACCCGCAGGGACATCGGCAACCGGACCTGGCTGCTCAGTGCCGTCGCCGCCATGGCTGCTAT
AGCTAATTAAGCTAGCTAGCTGCTGCTGCTAGGTAAGGTAGACGAGGAGGAGAGGAGTGAGCTAGCA